[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81119.1
DDBJ      :             SSU ribosomal protein S15P
Swiss-Prot:RS15_THETH   RecName: Full=30S ribosomal protein S15;

Homologs  Archaea  0/68 : Bacteria  881/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
a.16.1
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->89 2j00O PDBj 4e-40 100.0 %
:RPS:PDB   5->88 3bbnO PDBj 3e-25 34.5 %
:RPS:SCOP  3->87 1a32A  a.16.1.2 * 9e-22 51.8 %
:HMM:SCOP  2->89 1g1xB_ a.16.1.2 * 8e-35 59.1 %
:RPS:PFM   6->87 PF00312 * Ribosomal_S15 9e-16 57.3 %
:HMM:PFM   7->88 PF00312 * Ribosomal_S15 2.3e-35 54.9 82/83  
:BLT:SWISS 1->89 RS15_THETH 3e-40 100.0 %
:PROS 39->69|PS00362|RIBOSOMAL_S15
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81119.1 GT:GENE AAS81119.1 GT:PRODUCT SSU ribosomal protein S15P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 752546..752815 GB:FROM 752546 GB:TO 752815 GB:DIRECTION + GB:PRODUCT SSU ribosomal protein S15P GB:PROTEIN_ID AAS81119.1 GB:DB_XREF GI:46196703 LENGTH 89 SQ:AASEQ MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG GT:EXON 1|1-89:0| SW:ID RS15_THETH SW:DE RecName: Full=30S ribosomal protein S15; SW:GN Name=rpsO; Synonyms=rps15; SW:KW 3D-structure; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->89|RS15_THETH|3e-40|100.0|89/89| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 39->69|PS00362|RIBOSOMAL_S15|PDOC00313| SEG 62->72|qrrrllrylqr| BL:PDB:NREP 1 BL:PDB:REP 2->89|2j00O|4e-40|100.0|88/88| RP:PDB:NREP 1 RP:PDB:REP 5->88|3bbnO|3e-25|34.5|84/85| RP:PFM:NREP 1 RP:PFM:REP 6->87|PF00312|9e-16|57.3|82/83|Ribosomal_S15| HM:PFM:NREP 1 HM:PFM:REP 7->88|PF00312|2.3e-35|54.9|82/83|Ribosomal_S15| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00312|IPR000589| GO:PFM GO:0005622|"GO:intracellular"|PF00312|IPR000589| GO:PFM GO:0005840|"GO:ribosome"|PF00312|IPR000589| GO:PFM GO:0006412|"GO:translation"|PF00312|IPR000589| RP:SCP:NREP 1 RP:SCP:REP 3->87|1a32A|9e-22|51.8|85/85|a.16.1.2| HM:SCP:REP 2->89|1g1xB_|8e-35|59.1|88/88|a.16.1.2|1/1|S15/NS1 RNA-binding domain| OP:NHOMO 918 OP:NHOMOORG 908 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111-1111111111-111111111111111111111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111-111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111-111111111111111-1111111111111111111111111111-11111111111111111111111-1111111111111-1111111111111111111111112111111111111111111111111111111111111111111111111111111-1111111111111111111-1-11--1111111111111111-1---1111-111-11--11111111111111111 --------------------------------------------------------------1--1111-1--1--11111----------------------112---1----------------------------------------------------------------11--17---121------1-111-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 98.9 SQ:SECSTR #ccccHHHHHHHHHHcccccccccTTHHHHHHHHHHTTTTTTTTTcTTccTTcHHHHHHHHHHHHHHTTHHHHccHHHHTTTTTTTccc DISOP:02AL 89-90| PSIPRED ccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccc //