[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81128.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->33 PF09976 * DUF2133 2.6e-07 21.2 33/43  
:HMM:PFM   91->137 PF04277 * OAD_gamma 1.7e-05 43.5 46/79  
:HMM:PFM   31->71 PF08232 * Striatin 0.00027 29.3 41/135  
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81128.1 GT:GENE AAS81128.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(765538..765999) GB:FROM 765538 GB:TO 765999 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81128.1 GB:DB_XREF GI:46196712 LENGTH 153 SQ:AASEQ MRRWLPAVLALVLVAVLVFLGYQAYTAYQGLQARVAALEAQVQGQGEALKALSERVARLEEEVFRTPAEPLSPPPAPEVPAPPAWPYVVGVLVLLLLLYLFLRLLRAPEKPKEAPEKAEEKSPSQAASPEGVEEARMLDEGAPPPPPEEPRKG GT:EXON 1|1-153:0| COIL:NAA 35 COIL:NSEG 1 COIL:REGION 31->65| TM:NTM 2 TM:REGION 4->26| TM:REGION 85->107| SEG 5->18|lpavlalvlvavlv| SEG 67->86|paeplspppapevpappawp| SEG 88->105|vvgvlvlllllylflrll| SEG 107->121|apekpkeapekaeek| SEG 143->150|pppppeep| HM:PFM:NREP 3 HM:PFM:REP 1->33|PF09976|2.6e-07|21.2|33/43|DUF2133| HM:PFM:REP 91->137|PF04277|1.7e-05|43.5|46/79|OAD_gamma| HM:PFM:REP 31->71|PF08232|0.00027|29.3|41/135|Striatin| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 107-153| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccccccccccHHHHHHHHcccccccccccccc //