[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81132.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->49 PF01269 * Fibrillarin 0.00055 27.5 40/229  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81132.1 GT:GENE AAS81132.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 770037..770276 GB:FROM 770037 GB:TO 770276 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81132.1 GB:DB_XREF GI:46196716 LENGTH 79 SQ:AASEQ MPRPDRFRKKVLALLKEAGRPLHYTEIGRLLKEDGLWKDVKEPEKIAKIRLSALARWHRSPVVALGKGFYALREEADLP GT:EXON 1|1-79:0| HM:PFM:NREP 1 HM:PFM:REP 8->49|PF01269|0.00055|27.5|40/229|Fibrillarin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 78-79| PSIPRED cccHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHccHHHHHHccccc //