[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81133.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:43 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81133.1 GT:GENE AAS81133.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 770286..770417 GB:FROM 770286 GB:TO 770417 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81133.1 GB:DB_XREF GI:46196717 LENGTH 43 SQ:AASEQ MARYLLVLLLVVLALALEAYRPFLLLLAGLALLLARPRSCPRP GT:EXON 1|1-43:0| TM:NTM 1 TM:REGION 10->32| SEG 5->17|llvlllvvlalal| SEG 24->35|llllaglallla| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 40-43| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //