[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81136.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:40 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->26 PF00403 * HMA 2.8e-05 47.4 19/62  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81136.1 GT:GENE AAS81136.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(773046..773168) GB:FROM 773046 GB:TO 773168 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81136.1 GB:DB_XREF GI:46196720 LENGTH 40 SQ:AASEQ MEKNRYRIKVPGIHGAGCIRRVEQVAGVEKAWMGYPGEAL GT:EXON 1|1-40:0| HM:PFM:NREP 1 HM:PFM:REP 8->26|PF00403|2.8e-05|47.4|19/62|HMA| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccccEEEEEcccccHHHHHHHHHHHccHHHHcccccccc //