[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81142.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->126 PF10101 * DUF2339 3.5e-06 31.0 100/745  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81142.1 GT:GENE AAS81142.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 778671..779087 GB:FROM 778671 GB:TO 779087 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81142.1 GB:DB_XREF GI:46196726 LENGTH 138 SQ:AASEQ MAPNALQGLLKALADPEADPNLRRRALRAYGLFLLGLKGGLLLLLAPFLPPAPYPPLLLLAVLGVAWLYLQARSALEEEAPLGPLVAVGLGAGAFFFLGVLGLLLRPLGLLLLPLGLGAFWGFLRRGEEGLNAGARGP GT:EXON 1|1-138:0| TM:NTM 4 TM:REGION 28->50| TM:REGION 53->74| TM:REGION 79->101| TM:REGION 103->124| SEG 29->70|ayglfllglkgglllllapflppapyppllllavlgvawlyl| SEG 80->124|aplgplvavglgagaffflgvlglllrplgllllplglgafwgfl| HM:PFM:NREP 1 HM:PFM:REP 23->126|PF10101|3.5e-06|31.0|100/745|DUF2339| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 132-138| PSIPRED cccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccccc //