[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81145.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.8
:203 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  61->157 1gqiA1  c.1.8.10 * 7e-04 10.6 %
:HMM:PFM   52->66 PF07813 * LTXXQ 0.00011 53.3 15/23  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81145.1 GT:GENE AAS81145.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(780366..780977) GB:FROM 780366 GB:TO 780977 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81145.1 GB:DB_XREF GI:46196729 LENGTH 203 SQ:AASEQ MARPLPQTLFLDACVLYPAPIRDLFMGLALEGLVRLKWNRRVQEEWIHNLLQDRPDLTPEQQARIRATPEKMKEVLAFQEPLVEGYESLVEKIQLPDANDRHVVAAAWWGKAEAILTFNLKDFPEEELGRWELLALHPDDYLTELAERLIRKNFLPDPLLRVLKRQRCALRKPPLGVEDFLEILRRAGLATFTEALGPYKGHL GT:EXON 1|1-203:0| HM:PFM:NREP 1 HM:PFM:REP 52->66|PF07813|0.00011|53.3|15/23|LTXXQ| RP:SCP:NREP 1 RP:SCP:REP 61->157|1gqiA1|7e-04|10.6|94/561|c.1.8.10| OP:NHOMO 52 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- 2--1--------------------------------1--1---------------1-------------------1-----------------------------------------------------------------------2----1---------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------111----------1111111111--------1-----1----------------------------------------1-------------------1-------1--------1--11--1-1---1-------------------------------------------------------------------------11----1-------1---------------------------------1----------------------------------------1--------------------------------------------------11-1-1------------------------------1---1-1-----------------------------------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHccccEEEEcccccccHHHHHHccccEEcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHccc //