[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81160.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:250 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   109->170 PF05331 * DUF742 1.9e-05 32.3 62/114  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81160.1 GT:GENE AAS81160.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(797929..798681) GB:FROM 797929 GB:TO 798681 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81160.1 GB:DB_XREF GI:46196744 LENGTH 250 SQ:AASEQ MEGDFRLLGPIDLLQLLAQGGKTGAFRVEGGEVYLERGRPVHAAYGGVEGAEALLAVLALKEGRFRFFPGEAAPRRTLEGPLEAYLLEAVRRLGEGVEVGPFDLVRPTAAGLEAQATLEPEAFALLQAASGGKSPLDLAAATGLPLGRVLKGLGQLARLRLVEVSPRVPRTARLRVTLGGKGAQVDALLLKAWREHFGRVFRVRVRAGEREVLLPVEGAEGLGVVLSLSPELLLFHGLKAGEEVLVWPEV GT:EXON 1|1-250:0| SEG 41->63|vhaayggvegaeallavlalkeg| SEG 194->212|rehfgrvfrvrvragerev| HM:PFM:NREP 1 HM:PFM:REP 109->170|PF05331|1.9e-05|32.3|62/114|DUF742| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccccccccHHHHHHHHcccccEEEEEEccEEEEEccEEEEEEcccccHHHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHcHHHHcccccccccccccccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHEEEEEEEEcccEEEEEEccccccEEEEEEcHHHHHHHccccccEEEEEccc //