[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81177.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:RPS:PFM   58->133 PF04238 * DUF420 1e-06 36.8 %
:HMM:PFM   4->133 PF04238 * DUF420 1.3e-43 44.6 130/133  
:BLT:SWISS 91->136 YCT1_BACPF 1e-06 43.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81177.1 GT:GENE AAS81177.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(812432..812869) GB:FROM 812432 GB:TO 812869 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81177.1 GB:DB_XREF GI:46196761 LENGTH 145 SQ:AASEQ MKELLGLLAVWSIALSGAGVVVGVALIRRGERVWHHRVMLLATALAALFLVFYLAKWGLYGTTAYGGPEAWRGAYYLLLFTHTLLAALNGPLALYVIWRALRGEFALHRRWARILVPVWLYVALSGWVIYLVLKRYGVERGGIAF GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 91->136|YCT1_BACPF|1e-06|43.5|46/100| TM:NTM 4 TM:REGION 5->27| TM:REGION 36->58| TM:REGION 75->97| TM:REGION 113->134| SEG 12->30|sialsgagvvvgvalirrg| SEG 40->55|llatalaalflvfyla| SEG 74->88|ayylllfthtllaal| RP:PFM:NREP 1 RP:PFM:REP 58->133|PF04238|1e-06|36.8|76/133|DUF420| HM:PFM:NREP 1 HM:PFM:REP 4->133|PF04238|1.3e-43|44.6|130/133|DUF420| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //