[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81198.1
DDBJ      :             prepilin-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:156 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  6->154 1oqwA_ d.24.1.1 * 8.1e-12 22.8 %
:RPS:PFM   39->144 PF12019 * GspH 5e-06 36.7 %
:HMM:PFM   39->151 PF12019 * GspH 2.8e-14 27.4 106/114  
:HMM:PFM   4->22 PF07963 * N_methyl 1.8e-06 63.2 19/20  
:PROS 4->24|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81198.1 GT:GENE AAS81198.1 GT:PRODUCT prepilin-like protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 831428..831898 GB:FROM 831428 GB:TO 831898 GB:DIRECTION + GB:PRODUCT prepilin-like protein GB:PROTEIN_ID AAS81198.1 GB:DB_XREF GI:46196783 LENGTH 156 SQ:AASEQ MTRRGLTLLELLLVLGILGVLLGLALPLLSPNRLALDQAARSLATQVTRARLEAIRRNAFVGLQVFTEGAGGYLLFVDQNANRRYDPGEEFGATHFGQGNWARVRLDPEKSALGNMPLLFDPRGIPAKPITATLVLTSGGATRKVVISQQGRARLE GT:EXON 1|1-156:0| PROS 4->24|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 8->30| SEG 5->36|gltllelllvlgilgvllglalpllspnrlal| RP:PFM:NREP 1 RP:PFM:REP 39->144|PF12019|5e-06|36.7|98/116|GspH| HM:PFM:NREP 2 HM:PFM:REP 39->151|PF12019|2.8e-14|27.4|106/114|GspH| HM:PFM:REP 4->22|PF07963|1.8e-06|63.2|19/20|N_methyl| HM:SCP:REP 6->154|1oqwA_|8.1e-12|22.8|136/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 154-156| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccEEEEEEcccccccccccHHHEEcccccccccEEEEEccccccEEEEEEccccccccccEEEEEEEccccccEEEEEccccEEEc //