[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81199.1
DDBJ      :             prepilin-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:193 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  5->141 1oqwA_ d.24.1.1 * 1.1e-07 18.0 %
:HMM:PFM   3->21 PF07963 * N_methyl 9.8e-08 47.4 19/20  
:HMM:PFM   139->164 PF09962 * DUF2196 0.0002 46.2 26/62  
:PROS 3->23|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81199.1 GT:GENE AAS81199.1 GT:PRODUCT prepilin-like protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 831932..832513 GB:FROM 831932 GB:TO 832513 GB:DIRECTION + GB:PRODUCT prepilin-like protein GB:PROTEIN_ID AAS81199.1 GB:DB_XREF GI:46196784 LENGTH 193 SQ:AASEQ MRKGLTLVEVLVTLVIMGIAFAALLTSQLANLRASAQARFATDAKAAAVQVLERRSAEVLKSEIVPALSPYKDAPLDPDNPSGNWRSFYFVDYYFSCPTRVAPSPKQRGGSVANLRPGLTCSGTETIFGIPVAWDIRGENGILGEGVVTVVVTATHPRGPKVTLGRRVTCYDVYPSPTQDQPAPCPPPGGGRP GT:EXON 1|1-193:0| PROS 3->23|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 6->28| SEG 5->15|ltlvevlvtlv| SEG 147->153|vvtvvvt| SEG 175->192|psptqdqpapcpppgggr| HM:PFM:NREP 2 HM:PFM:REP 3->21|PF07963|9.8e-08|47.4|19/20|N_methyl| HM:PFM:REP 139->164|PF09962|0.0002|46.2|26/62|DUF2196| HM:SCP:REP 5->141|1oqwA_|1.1e-07|18.0|133/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 103-112, 181-193| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEEcccccccccHHHHcccccccccccEEccccEEEEccEEEEEccccccccccEEEEEEEEcccccccEEcccEEEEEEccccccccccccccccccccc //