[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81200.1
DDBJ      :             prepilin-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:233 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  5->87 1oqwA_ d.24.1.1 * 1e-10 28.0 %
:HMM:PFM   3->21 PF07963 * N_methyl 4.7e-08 63.2 19/20  
:HMM:PFM   36->169 PF11612 * GspJ 3.7e-06 17.7 130/169  
:BLT:SWISS 45->185 NSF1C_CHICK 8e-05 30.9 %
:PROS 3->23|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81200.1 GT:GENE AAS81200.1 GT:PRODUCT prepilin-like protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 832510..833211 GB:FROM 832510 GB:TO 833211 GB:DIRECTION + GB:PRODUCT prepilin-like protein GB:PROTEIN_ID AAS81200.1 GB:DB_XREF GI:46196785 LENGTH 233 SQ:AASEQ MKRGFTLVEVLVAMAILVVVLAVGVRYFASTSELARNTQARSELQDRVRMVMQVVTADLQMAGARYWNSGNQNQAFSLPLPPLSGSNMGPKDTLTLYYVTSLRDLASACRRVDYGFEGDTLRRSDVNATPSSGSDCTTPPPNSQPLAEGMLALDIQYQCSDGSRKDTPDCGTDAYPRSAKVTVAGYSLTSVTNPGPASLTTVTGKTLACPQGRACYALTQEVLMPNLKPLPTP GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 45->185|NSF1C_CHICK|8e-05|30.9|136/100| PROS 3->23|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 8->30| SEG 7->25|lvevlvamailvvvlavgv| HM:PFM:NREP 2 HM:PFM:REP 3->21|PF07963|4.7e-08|63.2|19/20|N_methyl| HM:PFM:REP 36->169|PF11612|3.7e-06|17.7|130/169|GspJ| HM:SCP:REP 5->87|1oqwA_|1e-10|28.0|82/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 37-42, 127-140, 231-233| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccccccccEEEEHHHHHHHHHHHHHHcccccccccEEccccccccccccccccccccccHHHccEEEEEEEEEcccccccccccccccccccccEEEEEcEEEEcccccccccEEEEcccEEEcccccHHHHHHHHHHcccccccccc //