[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81204.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:180 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  7->177 1wdjA  c.52.1.27 * 2e-25 19.4 %
:HMM:SCOP  1->177 1wdjA_ c.52.1.27 * 2.6e-31 30.1 %
:RPS:PFM   82->123 PF05685 * DUF820 5e-04 57.1 %
:HMM:PFM   43->145 PF05685 * DUF820 1.7e-21 32.7 101/111  
:BLT:SWISS 13->177 Y925_SYNY3 2e-25 41.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81204.1 GT:GENE AAS81204.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 837706..838248 GB:FROM 837706 GB:TO 838248 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAS81204.1 GB:DB_XREF GI:46196789 LENGTH 180 SQ:AASEQ MGAAKQVRPLTLEEYLALEREAPVKHELVEGFPHAMAGASDRHNRVVVNLVLALGPLARKRGCRLYASDMRLKVDAATVYYPDLMVVCEEDPGEYYKEKPCLVIEVLSDSTEATDRREKLRKYLDLPTLQAYLLLDSRTPRAFGYYREGEGWVYREAEAGTLPLPCLGGHLDLAEAYHGL GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 13->177|Y925_SYNY3|2e-25|41.8|158/202| RP:PFM:NREP 1 RP:PFM:REP 82->123|PF05685|5e-04|57.1|42/112|DUF820| HM:PFM:NREP 1 HM:PFM:REP 43->145|PF05685|1.7e-21|32.7|101/111|DUF820| RP:SCP:NREP 1 RP:SCP:REP 7->177|1wdjA|2e-25|19.4|170/186|c.52.1.27| HM:SCP:REP 1->177|1wdjA_|2.6e-31|30.1|176/0|c.52.1.27|1/1|Restriction endonuclease-like| OP:NHOMO 172 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------4--------------------------1----1----2-1A36BBG-111------93148982--------------244----1-------------------------11-----------------------------------------------------------------------------------------------------------------------------------------1-----------------1---------1---1----1--1------------33132132---------------------------------------------3--------------------------------------------------------------------------3---1-2------1------------------------------------------------9-------------------------2--------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccccccEEcHHHHHHcccccccEEEEEccEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEccEEEEEccccEEEEEEEEEEcccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEccccEEEEEEcccEEEEccccEEEEHHHHcccc //