[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81205.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->33 PF10047 * DUF2281 8.6e-10 36.7 30/66  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81205.1 GT:GENE AAS81205.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 838286..838486 GB:FROM 838286 GB:TO 838486 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81205.1 GB:DB_XREF GI:46196790 LENGTH 66 SQ:AASEQ MTAKEEVLALLERMPEALQKEVADFARFLLEKRLGEELLWQSLSLAQAVRGLPEEDYTEADLKERW GT:EXON 1|1-66:0| HM:PFM:NREP 1 HM:PFM:REP 4->33|PF10047|8.6e-10|36.7|30/66|DUF2281| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccc //