[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81208.1
DDBJ      :             tryptophanyl-tRNA synthetase
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  910/915 : Eukaryota  177/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:337 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->331 2el7A PDBj 0.0 100.0 %
:RPS:PDB   2->308 2akeA PDBj 2e-62 18.6 %
:RPS:SCOP  4->295 1o5tA  c.26.1.1 * 8e-45 22.7 %
:HMM:SCOP  1->329 1d2rA_ c.26.1.1 * 1e-92 40.2 %
:RPS:PFM   3->260 PF00579 * tRNA-synt_1b 4e-50 48.2 %
:HMM:PFM   3->272 PF00579 * tRNA-synt_1b 3.4e-73 41.2 262/292  
:BLT:SWISS 1->328 SYW_DEIRA e-117 59.1 %
:PROS 10->19|PS00178|AA_TRNA_LIGASE_I

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81208.1 GT:GENE AAS81208.1 GT:PRODUCT tryptophanyl-tRNA synthetase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(839818..840831) GB:FROM 839818 GB:TO 840831 GB:DIRECTION - GB:PRODUCT tryptophanyl-tRNA synthetase GB:PROTEIN_ID AAS81208.1 GB:DB_XREF GI:46196793 LENGTH 337 SQ:AASEQ MKRVLSGIQPSGEIHIGNYLGAIKQWVAIGEKLGRDAFFCIVDYHALTNPLAYDPSTLAQRTFEAALVNIAAGLDPEKVTLFVQSHVPEHTELSWVFTTLTPLGDLTRMTQFKDKASKQETVWSGLLMYPVLQAADILIYKADTVPVGEDQVQHIELTREIARRFNHLFGETFPEPQALLNPEAPRVPGIDGKAKMSKSLGNTIGLLEPEESIWQKIQHLPDDPQRIRLSDPGDPERTILFTYLSYFAPKDLVEALKEEYRKAGVGTYVVKRILFDHLMEALRPIRERAEALKKDPDYVMDALLEGAKRARAVAQATMEEVREKVGLLLPRKRPVLR GT:EXON 1|1-337:0| BL:SWS:NREP 1 BL:SWS:REP 1->328|SYW_DEIRA|e-117|59.1|328/330| PROS 10->19|PS00178|AA_TRNA_LIGASE_I|PDOC00161| BL:PDB:NREP 1 BL:PDB:REP 1->331|2el7A|0.0|100.0|318/318| RP:PDB:NREP 1 RP:PDB:REP 2->308|2akeA|2e-62|18.6|296/373| RP:PFM:NREP 1 RP:PFM:REP 3->260|PF00579|4e-50|48.2|247/279|tRNA-synt_1b| HM:PFM:NREP 1 HM:PFM:REP 3->272|PF00579|3.4e-73|41.2|262/292|tRNA-synt_1b| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00579|IPR002305| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00579|IPR002305| GO:PFM GO:0005524|"GO:ATP binding"|PF00579|IPR002305| GO:PFM GO:0005737|"GO:cytoplasm"|PF00579|IPR002305| GO:PFM GO:0006412|"GO:translation"|PF00579|IPR002305| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00579|IPR002305| RP:SCP:NREP 1 RP:SCP:REP 4->295|1o5tA|8e-45|22.7|278/378|c.26.1.1| HM:SCP:REP 1->329|1d2rA_|1e-92|40.2|321/0|c.26.1.1|1/1|Nucleotidylyl transferase| OP:NHOMO 1454 OP:NHOMOORG 1110 OP:PATTERN 1111-1-----------------1-----1----11112122111-1-1-----1--1---------1 2121211111111111111-11111111111111111111112112111111111112112121212222112111112221221222111111111111121111111111111111111111112111111111111111111222122221111222122122122221222112212213322222122122222122222222222111121211121111111111211111111111111111111211111111111111111111111111111111111111111111111111111211111111111111111122222222222211111111211111111223121221221111211221111111111111111111111111111111111-11112111112121111111111111111111111111111111111111111111111111111211111111111111111111111111111222122222221121222212222111122111112111211111122212221111111111211111122121112221222222223111111111111111111211111111112121222211111121122222222222222222221-2222211111121112211111111111-11111111111111111112221211221222222222222222111111111111111111111111222222222221211222222222121222222222222221222222223222222221111111111211211111232111122222122211111112211111111111111111111-11111111111111111111221121112211 1---111-1---1111111-1-1-11111111111111111111111111111111111111111111111111111--111111111-1111111---1111111--2121-1112111111121111292-112111111111111111111-121112511111111512221111I111-121211311121112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 331 STR:RPRED 98.2 SQ:SECSTR cEEEEEEEcccccccHHHHHHHHHHHHHHHHHTTccEEEEEcHHHHHHHcGcccHHHHHHHHHHHHHHHHTTTccTTcEEEEEHHHHHHHTTccHHHHHHHHHHHTccHHHHHHHHcccTTccHHHHTHHHHHHGGGcGGGcHEEEEEGGGHHHHHHHHHHHHHTTccccEEccccEEEEEcccccTTccccccccTTcGGGcccTTccHHHHHHHHHHHccccccccHHHcccTTTcHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHTcccccccHHHHHHHHHHHHHHHHHTccccc###### DISOP:02AL 113-121, 185-202, 335-337| PSIPRED ccEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHccHHHHHHcccccccccccccccccccccccccccccEEEccccHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //