[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81212.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:177 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  5->175 1wdjA  c.52.1.27 * 6e-21 17.3 %
:HMM:SCOP  5->176 1wdjA_ c.52.1.27 * 3.9e-20 28.4 %
:RPS:PFM   103->144 PF05685 * DUF820 4e-04 45.2 %
:HMM:PFM   46->145 PF05685 * DUF820 5.1e-21 30.0 100/111  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81212.1 GT:GENE AAS81212.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 844237..844770 GB:FROM 844237 GB:TO 844770 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAS81212.1 GB:DB_XREF GI:46196797 LENGTH 177 SQ:AASEQ MIRHRFSAEDFHRMAEAGILGEDDRVELIRGEVVELSPIGKRHAYVLNALVDLLAPLRGKALLSVQNPLLLSPDTEVYPDLALLQPPRTRYRDRLPEAKDALLVVEVAETSLDHDLKVKLPLYAQAGIPEVWVVDLVREKVHVFRKPQGEGYGEAQALEDGELSVLGLKVPVKEVLP GT:EXON 1|1-177:0| RP:PFM:NREP 1 RP:PFM:REP 103->144|PF05685|4e-04|45.2|42/112|DUF820| HM:PFM:NREP 1 HM:PFM:REP 46->145|PF05685|5.1e-21|30.0|100/111|DUF820| RP:SCP:NREP 1 RP:SCP:REP 5->175|1wdjA|6e-21|17.3|168/186|c.52.1.27| HM:SCP:REP 5->176|1wdjA_|3.9e-20|28.4|169/0|c.52.1.27|1/1|Restriction endonuclease-like| OP:NHOMO 92 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------1---------------------------------------2-------------------------------4----34855662-1---------1-84461---------------78---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------11-----------------------------------1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 176-178| PSIPRED cccccccHHHHHHHHHccccccccEEEEEccEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEccEEEEccccEEcccEEEEcccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEccccEEEEEEccccccEEEEEEEccccEEccccEEEHHHHcc //