[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81222.1
DDBJ      :             cell division factor-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.71.1
:73 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  23->72 1ev0A  d.71.1.1 * 2e-05 30.0 %
:HMM:SCOP  23->74 1ev0A_ d.71.1.1 * 1.5e-08 34.6 %
:RPS:PFM   11->72 PF03776 * MinE 8e-10 51.6 %
:HMM:PFM   7->73 PF03776 * MinE 3.8e-22 47.8 67/70  
:BLT:SWISS 2->72 MINE_DEIDV 3e-18 59.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81222.1 GT:GENE AAS81222.1 GT:PRODUCT cell division factor-like protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(853020..853241) GB:FROM 853020 GB:TO 853241 GB:DIRECTION - GB:PRODUCT cell division factor-like protein GB:PROTEIN_ID AAS81222.1 GB:DB_XREF GI:46196807 LENGTH 73 SQ:AASEQ MWWRRRSKEKAKERLKLVLAYDRARLSPGMVESLKRDLLEVLRRYFPAQEEGLSVALEERGEKMVLVADIPLR GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 2->72|MINE_DEIDV|3e-18|59.4|69/83| RP:PFM:NREP 1 RP:PFM:REP 11->72|PF03776|8e-10|51.6|62/68|MinE| HM:PFM:NREP 1 HM:PFM:REP 7->73|PF03776|3.8e-22|47.8|67/70|MinE| GO:PFM:NREP 2 GO:PFM GO:0032955|"GO:regulation of barrier septum formation"|PF03776|IPR005527| GO:PFM GO:0051301|"GO:cell division"|PF03776|IPR005527| RP:SCP:NREP 1 RP:SCP:REP 23->72|1ev0A|2e-05|30.0|50/58|d.71.1.1| HM:SCP:REP 23->74|1ev0A_|1.5e-08|34.6|52/58|d.71.1.1|1/1|Cell division protein MinE topological specificity domain| OP:NHOMO 43 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------11-----111111-1111--1--11-1-1111-------1----1111111-----------------------------------------------------------------------------------------------------------------------------------------1-----------1--------1--1-111111111--11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 9-10| PSIPRED cccccccHHHHHHHHEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccEEEEEEEEEcc //