[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81227.1
DDBJ      :             protein kinase-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->127 1hkxI PDBj 4e-09 26.2 %
:RPS:PDB   1->123 2chcA PDBj 4e-08 13.6 %
:RPS:SCOP  4->127 1hkxA  d.17.4.7 * 3e-22 25.8 %
:HMM:SCOP  4->130 1hkxA_ d.17.4.7 * 2.1e-15 25.2 %
:HMM:PFM   4->128 PF08332 * CaMKII_AD 1.5e-51 35.2 125/128  
:BLT:SWISS 6->127 KCC2A_RAT 1e-08 26.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81227.1 GT:GENE AAS81227.1 GT:PRODUCT protein kinase-like protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 856128..856514 GB:FROM 856128 GB:TO 856514 GB:DIRECTION + GB:PRODUCT protein kinase-like protein GB:PROTEIN_ID AAS81227.1 GB:DB_XREF GI:46196812 LENGTH 128 SQ:AASEQ MEGEAELWNFLERHLRSIYEGDWATYEATTHEELSLYEWFVTPHRLDGLPFHRFMVEKNWATRGRAYRLDLLEKRLQRYGDVAIFSYTLLLTVEEEAGLRHRAVNESRVAVRFPEGWKVVHVHKSPAG GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 6->127|KCC2A_RAT|1e-08|26.2|122/478| BL:PDB:NREP 1 BL:PDB:REP 6->127|1hkxI|4e-09|26.2|122/134| RP:PDB:NREP 1 RP:PDB:REP 1->123|2chcA|4e-08|13.6|118/169| HM:PFM:NREP 1 HM:PFM:REP 4->128|PF08332|1.5e-51|35.2|125/128|CaMKII_AD| RP:SCP:NREP 1 RP:SCP:REP 4->127|1hkxA|3e-22|25.8|124/140|d.17.4.7| HM:SCP:REP 4->130|1hkxA_|2.1e-15|25.2|127/0|d.17.4.7|1/1|NTF2-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 99.2 SQ:SECSTR HHHHHHHHHHHHHHHHHHTTTcHHHHHTTEEEEEEEEEEEETTEEEEcHHHHHHHHHHHHHHccccEEEEEEEEEEEEETTEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEETTEEEEEEEEcccc# DISOP:02AL 1-2, 127-128| PSIPRED ccHHHHHHHHHHHHHHHHHcccHHHHcccccccccEEccccccEEEcccccHHHEEEcccccccccEEEEEEcccEEEEEcHHHHHHHHEEEEEEccccccccccccEEEEEEcccEEEEEEEEcccc //