[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81235.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.17
:69 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   1->64 1afiA PDBj 6e-05 21.9 %
:RPS:SCOP  1->64 2qifA1  d.58.17.1 * 4e-06 21.9 %
:HMM:PFM   19->54 PF00873 * ACR_tran 3.1e-05 38.9 36/1021  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81235.1 GT:GENE AAS81235.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 868990..869199 GB:FROM 868990 GB:TO 869199 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81235.1 GB:DB_XREF GI:46196820 LENGTH 69 SQ:AASEQ MNRVLIGIRGEPTPEGMERILKALKRLEGVAEVQATGPAQVLVAYDPQSLTVMDLIRIIREEGFLAGML GT:EXON 1|1-69:0| RP:PDB:NREP 1 RP:PDB:REP 1->64|1afiA|6e-05|21.9|64/72| HM:PFM:NREP 1 HM:PFM:REP 19->54|PF00873|3.1e-05|38.9|36/1021|ACR_tran| RP:SCP:NREP 1 RP:SCP:REP 1->64|2qifA1|4e-06|21.9|64/69|d.58.17.1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 92.8 SQ:SECSTR cEEEEEEcTTcccccHHHHHHHHHHTTccEEEEEEETTTTEEEEEcTTTccHHHHHHHHHHHTc##### PSIPRED ccEEEEEEcccccHHHHHHHHHHHHHcccHHHcccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHcc //