[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81243.1
DDBJ      :             hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:284 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  38->144 1s7bA_ f.39.1.1 * 1.6e-15 37.1 %
:HMM:SCOP  181->283 1s7bA_ f.39.1.1 * 2.2e-16 42.4 %
:HMM:PFM   14->136 PF00892 * EamA 9.9e-25 35.8 123/126  
:HMM:PFM   158->281 PF00892 * EamA 3.4e-27 35.8 123/126  
:BLT:SWISS 11->257 YDFC_BACSU 3e-22 30.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81243.1 GT:GENE AAS81243.1 GT:PRODUCT hypothetical membrane spanning protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(878968..879822) GB:FROM 878968 GB:TO 879822 GB:DIRECTION - GB:PRODUCT hypothetical membrane spanning protein GB:PROTEIN_ID AAS81243.1 GB:DB_XREF GI:46196828 LENGTH 284 SQ:AASEQ MEPRALGAAFLTILFWASAFAAIRAGLEGLEPGHLVLLRFLVAGALLLLYALLRGLPPPRREDLPRLFLLGFLGITVYHTALVYGELTVSAGAASLLIAMGPVFTALLSHFFLGERLGRRGVFGFGLAFLGSALIAFGEGGGVGLSPGAFLVLLAALSTSFYFVLQKPLFGRYGSEEMTVYTLLLGTLPLFVFLPGLPEAIRTAPRPALLSAFYLGVFPGALAYLTWTYALSRTPASRLSSFLYLSPPLAVLIAYLWLGEVPSPLSLLGGGLALLGVLLVNLRA GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 11->257|YDFC_BACSU|3e-22|30.0|247/306| TM:NTM 10 TM:REGION 5->27| TM:REGION 35->57| TM:REGION 64->86| TM:REGION 91->113| TM:REGION 121->141| TM:REGION 143->165| TM:REGION 177->199| TM:REGION 203->225| TM:REGION 239->261| TM:REGION 263->284| SEG 35->70|lvllrflvagallllyallrglppprredlprlfll| SEG 111->138|fflgerlgrrgvfgfglaflgsaliafg| SEG 182->197|tlllgtlplfvflpgl| SEG 258->282|lgevpsplsllggglallgvllvnl| HM:PFM:NREP 2 HM:PFM:REP 14->136|PF00892|9.9e-25|35.8|123/126|EamA| HM:PFM:REP 158->281|PF00892|3.4e-27|35.8|123/126|EamA| HM:SCP:REP 38->144|1s7bA_|1.6e-15|37.1|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 181->283|1s7bA_|2.2e-16|42.4|99/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 75 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- ----1-----------------------------------------------111-------1----1-------------------------------------------------------------------------111---------------------------------------11111------11111111-1111111----1111-------------1--11---111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1111111---------------------------1--------------------------------------------111111--------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111----------1-1-----------1111------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 284-285| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccc //