[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81247.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   106->175 3btaA PDBj 5e-10 2.9 %
:PROS 111->120|PS00142|ZINC_PROTEASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81247.1 GT:GENE AAS81247.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 884564..885340 GB:FROM 884564 GB:TO 885340 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81247.1 GB:DB_XREF GI:46196832 LENGTH 258 SQ:AASEQ MRAHPHPHLPAFFSEGGALRAKALQGYLLSLREVYVRYAPLPPVRLFVLSEKDWRARLPYPYGLPFQHAGPEGLSVYAPLTYPERLLHRLREVLLPLGPPPGEIPAFLDLNLGHEYAHAVQVAWRLRTGARWLDEFVANYLFLLGLRRARPDLAEGLLAWSEHLARLAPEKRRLSDYERRRGGLEGALWFQARFTLMAQALWEKDGDGLLLALLEAAPLDRKRGHRLLVERYPELREWFRGFGLKAAPGGASSPRQAP GT:EXON 1|1-258:0| PROS 111->120|PS00142|ZINC_PROTEASE|PDOC00129| SEG 83->102|perllhrlrevllplgpppg| SEG 209->219|lllalleaapl| RP:PDB:NREP 1 RP:PDB:REP 106->175|3btaA|5e-10|2.9|69/1277| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 26.7 SQ:SECSTR #########################################################################################################cTTccGGEEEEEcTTccEEEcccTTccEEEccccccccTTTcccc#ccEEEEccccEEcEEccccGGGTc################################################################################### DISOP:02AL 1-5, 173-176, 248-258| PSIPRED ccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccEEcccccccccccccccccEEEEccccHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHcccHHHHHccHHHHHHHHHccccccccccccccccc //