[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81252.1
DDBJ      :             V-type ATP synthase subunit F
Swiss-Prot:VATF_THET2   RecName: Full=V-type ATP synthase subunit F;AltName: Full=V-ATPase subunit F;

Homologs  Archaea  1/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.149.1
:104 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->104 2d00A PDBj 2e-54 99.0 %
:RPS:PDB   1->104 3a5cH PDBj 9e-24 99.0 %
:RPS:SCOP  1->104 2d00A1  c.149.1.1 * 8e-24 99.0 %
:HMM:PFM   1->94 PF01990 * ATP-synt_F 1.2e-19 32.6 92/96  
:BLT:SWISS 1->104 VATF_THET2 1e-54 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81252.1 GT:GENE AAS81252.1 GT:PRODUCT V-type ATP synthase subunit F GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(890254..890568) GB:FROM 890254 GB:TO 890568 GB:DIRECTION - GB:PRODUCT V-type ATP synthase subunit F GB:PROTEIN_ID AAS81252.1 GB:DB_XREF GI:46196837 LENGTH 104 SQ:AASEQ MAVIADPETAQGFRLAGLEGYGASSAEEAQSLLETLVERGGYALVAVDEALLSDPERAVERLMRGRDLPVLLPIAGLKEAFQGHDVEGYMRELVRKTIGFDIKL GT:EXON 1|1-104:0| SW:ID VATF_THET2 SW:DE RecName: Full=V-type ATP synthase subunit F;AltName: Full=V-ATPase subunit F; SW:GN Name=atpF; OrderedLocusNames=TT_C0908; SW:KW ATP synthesis; Complete proteome; Hydrogen ion transport;Ion transport; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->104|VATF_THET2|1e-54|100.0|104/104| GO:SWS:NREP 4 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 1->104|2d00A|2e-54|99.0|104/109| RP:PDB:NREP 1 RP:PDB:REP 1->104|3a5cH|9e-24|99.0|104/104| HM:PFM:NREP 1 HM:PFM:REP 1->94|PF01990|1.2e-19|32.6|92/96|ATP-synt_F| RP:SCP:NREP 1 RP:SCP:REP 1->104|2d00A1|8e-24|99.0|104/104|c.149.1.1| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------------------------------------1-------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 100.0 SQ:SECSTR cEEEEcHHHHHHHHHTTcEEEEcccHHHHHHHHHHHHHHccccEEEEETTTcccHHHHHHHHcccccccEEEEEccccTTTcccTTHHHHHHHHHHHHcccccc DISOP:02AL 104-105| PSIPRED cEEEEcccccccEEEccEEEEEEccHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHcccccccEEEEccccccccccccHHHHHHHHHHHHHccEEEc //