[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81257.1
DDBJ      :             V-type ATPase subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->94 PF05823 * Gp-FAR-1 0.00012 28.7 87/154  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81257.1 GT:GENE AAS81257.1 GT:PRODUCT V-type ATPase subunit GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(894441..894755) GB:FROM 894441 GB:TO 894755 GB:DIRECTION - GB:PRODUCT V-type ATPase subunit GB:PROTEIN_ID AAS81257.1 GB:DB_XREF GI:46196842 LENGTH 104 SQ:AASEQ MGGLGLIKSLAEKEKQLLERLEAAKKEAEERVKRAEAEAKALLEEAEAKAKALEAQYRERERAETEALLARYRERAEAEAKAVREKAMARLDEAVALVLKEVLP GT:EXON 1|1-104:0| COIL:NAA 65 COIL:NSEG 1 COIL:REGION 6->70| SEG 10->90|laekekqllerleaakkeaeervkraeaeakalleeaeakakaleaqyrereraeteallaryreraeaeakavrekamar| HM:PFM:NREP 1 HM:PFM:REP 7->94|PF05823|0.00012|28.7|87/154|Gp-FAR-1| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 19-40, 53-60, 79-81| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //