[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81270.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81270.1 GT:GENE AAS81270.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(907923..908321) GB:FROM 907923 GB:TO 908321 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81270.1 GB:DB_XREF GI:46196855 LENGTH 132 SQ:AASEQ MPRLRRLEDLLPHIREGRYRLGPHAAKHMLQEGFREQDILSALLWGRELAIYPEDERMLVLGYMVFPPRLRLPLHVVLEYSTPRHVDIVTAFIPREPYRVYSRARLAALLRFDGALEEVRWTGPKHLYPPWD GT:EXON 1|1-132:0| SEG 67->74|pprlrlpl| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHccEEEEccccccEEEEEEEEcccccccEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHHccccHHHEEEccccccccccc //