[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81274.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->69 PF05239 * PRC 0.00079 30.8 26/79  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81274.1 GT:GENE AAS81274.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(911073..911417) GB:FROM 911073 GB:TO 911417 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81274.1 GB:DB_XREF GI:46196859 LENGTH 114 SQ:AASEQ MGETFAEVKRELIALLRPGVRVPNWSKAAEKNPGRLKRREFVVLEVDKAKGLALQSGEKRVEVPWGALENVWRKWRDYRECRLKRKDLAEKNFFTTYCIALLRFLEENLGGPRV GT:EXON 1|1-114:0| HM:PFM:NREP 1 HM:PFM:REP 40->69|PF05239|0.00079|30.8|26/79|PRC| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 26-35, 112-114| PSIPRED cccHHHHHHHHHHHHHcccccccccccHHccccccccHHEEEEEEEccccccEEcccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //