[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81283.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81283.1 GT:GENE AAS81283.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(920635..920967) GB:FROM 920635 GB:TO 920967 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81283.1 GB:DB_XREF GI:46196868 LENGTH 110 SQ:AASEQ MRSILPLGVALALFLLLFATFRFTGLGFFLALGGGALGYLGLARWQEGLLSRGPSLAALERLAMREAWRRGGVLRPGDLSAFLPEEEAEKLLEGLAARGLCRKEGEGYRF GT:EXON 1|1-110:0| TM:NTM 2 TM:REGION 2->24| TM:REGION 30->52| SEG 5->43|lplgvalalflllfatfrftglgfflalgggalgylgla| SEG 56->70|laalerlamreawrr| SEG 81->97|aflpeeeaeklleglaa| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 104-110| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccc //