[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81296.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81296.1 GT:GENE AAS81296.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 933943..934341 GB:FROM 933943 GB:TO 934341 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81296.1 GB:DB_XREF GI:46196881 LENGTH 132 SQ:AASEQ MRLPFRPLPLGLLALGGLLLLRLVAVEGEGARRLLVLFPWSRGEVAFVNSVTGRPVRLLFYPLWDFRGFRALTDPETEAYYTGGEYAWNEVLAQERRRELVYCSEVGLSLALGPWRFWAEGGCLRARLLWPP GT:EXON 1|1-132:0| TM:NTM 1 TM:REGION 10->31| SEG 2->23|rlpfrplplgllalggllllrl| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEccccccEEEEEcccccEEEEEEEEcccccccEEcccccccEEEEcccHHHHHHHHHHHHHHEEEEEccccEEEEccEEEEccccEEEEEEEccc //