[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81342.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  352/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.349.1
:236 amino acids
:PSIPRED
:RPS:SCOP  136->203 2jovA1  d.349.1.1 * 2e-13 8.8 %
:HMM:PFM   26->83 PF02754 * CCG 2.8e-13 32.8 58/64  
:HMM:PFM   153->210 PF02754 * CCG 2.5e-12 29.3 58/64  
:BLT:SWISS 1->230 LUTA2_BACCZ 9e-49 41.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81342.1 GT:GENE AAS81342.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 979933..980643 GB:FROM 979933 GB:TO 980643 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAS81342.1 GB:DB_XREF GI:46196927 LENGTH 236 SQ:AASEQ MRVALFITCLADQFYAEAGVAAVRLLRALGVEVDFPQGQTCCGQPAFNAGYWDEARPLAKRTLEVFEEAEYVVLPSGSCASMVKNHYPELLPGNREALAMAEKTYELSQFLVRVLGVEKLGEGLKGRRVAYHHGCHALRELGVREEPLLLLQNAGAEILPWEAWEECCGFGGLFSVKLPEVSLAMADRKLATLPKAEVLTSTDAGCLLHLAGRLGKKGENLRVAPLATLLWEAYAG GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 1->230|LUTA2_BACCZ|9e-49|41.5|229/242| SEG 16->33|aeagvaavrllralgvev| SEG 111->127|lvrvlgveklgeglkgr| HM:PFM:NREP 2 HM:PFM:REP 26->83|PF02754|2.8e-13|32.8|58/64|CCG| HM:PFM:REP 153->210|PF02754|2.5e-12|29.3|58/64|CCG| RP:SCP:NREP 1 RP:SCP:REP 136->203|2jovA1|2e-13|8.8|68/77|d.349.1.1| OP:NHOMO 530 OP:NHOMOORG 365 OP:PATTERN ---------------------------------1111-11111---1------1-------------- 212-111-----1--------1---1------1111-111-1----11-----1-11------1122111-----------12--1111111-111-----1---211-2--------------------------22233----3---111---11---111-1--11-1------------22222---22222222112221211243222211223311-1------211-------------------1---11-------1111-1----111------------------------------------------------------------------------1--2-56-231--33-----1-122---------11-----1-----------------221221212---111---1--1---1----11----1--1111111111111122----------------------------------1-111-2113122222122232222122323332--111--------1---11----111111111111222-2414233232333-3131133-31121---32--21222221222222222111-1--1---1-1--1211111-111111111111----11-1------1-211--1111111111-111111211111111-11----1---2------------------1-1111---------------------------1-1--1111111----1111----------1------11------1----------------2--------11----------------------------------------------------------------------11- -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEHHHHHHHccHHHHHHHHHHHHHcccEEEEccccccccHHHHHcccHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccHHHHHHcccHHHHHHHHHHcccEEEEccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHccccccEEEHHHHHHHHHcc //