[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81347.1
DDBJ      :             serine protease-like protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  524/915 : Eukaryota  198/199 : Viruses  4/175   --->[See Alignment]
d.144.1
:253 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->204 2w4oA PDBj 4e-24 41.7 %
:RPS:PDB   11->248 3dbsA PDBj 5e-24 7.6 %
:RPS:SCOP  11->249 1nw1A  d.144.1.8 * 3e-27 8.4 %
:HMM:SCOP  3->249 1howA_ d.144.1.7 * 1.4e-54 36.2 %
:RPS:PFM   14->249 PF00069 * Pkinase 2e-28 36.9 %
:HMM:PFM   12->249 PF00069 * Pkinase 5.8e-41 30.4 237/260  
:BLT:SWISS 8->199 PKNA2_BIFLO 1e-26 38.0 %
:PROS 122->134|PS00108|PROTEIN_KINASE_ST
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81347.1 GT:GENE AAS81347.1 GT:PRODUCT serine protease-like protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 984175..984936 GB:FROM 984175 GB:TO 984936 GB:DIRECTION + GB:PRODUCT serine protease-like protein GB:PROTEIN_ID AAS81347.1 GB:DB_XREF GI:46196932 LENGTH 253 SQ:AASEQ MSLVGKTLSGRYRVVRPLARGALARVYLAFDPFGTPYALKLFPPKARPRRDRELWVGRRLAHPNLNPVLEALDLEEGPALLLAYAPGEELGRWMGKSPAFSQAMRVFHQLLLALAHMHEKGLVHRDVKPENILVNAGEARLLDFDLSGPAQERFQKPLLLGTPAYLAPELLRGLPSGPEADVYAAGIILYWMLTGEHPFADPSGRVSLDPDRGPHPPVAGLGEEAALYLERLLAPDPKARFPTAQEALKAFPF GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 8->199|PKNA2_BIFLO|1e-26|38.0|192/757| PROS 122->134|PS00108|PROTEIN_KINASE_ST|PDOC00100| SEG 219->234|aglgeeaalylerlla| BL:PDB:NREP 1 BL:PDB:REP 8->204|2w4oA|4e-24|41.7|175/278| RP:PDB:NREP 1 RP:PDB:REP 11->248|3dbsA|5e-24|7.6|237/841| RP:PFM:NREP 1 RP:PFM:REP 14->249|PF00069|2e-28|36.9|233/256|Pkinase| HM:PFM:NREP 1 HM:PFM:REP 12->249|PF00069|5.8e-41|30.4|237/260|Pkinase| GO:PFM:NREP 3 GO:PFM GO:0004672|"GO:protein kinase activity"|PF00069|IPR017442| GO:PFM GO:0005524|"GO:ATP binding"|PF00069|IPR017442| GO:PFM GO:0006468|"GO:protein amino acid phosphorylation"|PF00069|IPR017442| RP:SCP:NREP 1 RP:SCP:REP 11->249|1nw1A|3e-27|8.4|238/365|d.144.1.8| HM:SCP:REP 3->249|1howA_|1.4e-54|36.2|243/362|d.144.1.7|1/1|Protein kinase-like (PK-like)| OP:NHOMO 22323 OP:NHOMOORG 740 OP:PATTERN -------------1---111111--------------------31--2-------1-4---1--1--- 4Q*4Y443333344688BB-BB33NCBBBBBABDDEI7XO3eNj45335444659434227783JDIQNOL544456621118-------2--1-----------1--11211111122222222--------2--AAAIJ---S2W9EJ7798955------6389WTVK------------56544112111111111111111111111211111111111122223222111111-1111111111111111111211111111111-1111111111111111111111111111111111111111111111111112112211111111211111111121311-131112122111211111---S-e1---------2211---21111------------11-1-1-1-2---11211-11---11-4--1-------1222222221----4--------------------------------11-------2211111-1111--321111111-13211-11115532222233222622211-----------395-95521-1-1-111----2----1FGJF**-3-----------------------11----22173-3-2-1---2221111-121-33------2---------------1--------1---------1---------------------------1-1---------------------------3-----111111C12---------------111111-12115333321234212132-1----------2212-----11122--2-3--111----113-111111---------------1-11--1-1---1--11-----1---------42 JGIJ***3***hx**cefVbhlgagceYWUaEabcaaeZdYbcfacUZhfdahdWeYTaceecabaYcGTdeZXZkpRjnYSTTUWgk-p*ieevrdWcghVX***C*************************U*******************r*************t********K**k*dYa*y****b**i****** --------------------------------------------------------------------------------------------------------------------------------------------1-------------1---------------32--- STR:NPRED 253 STR:RPRED 100.0 SQ:SECSTR ccEEEccccGEEEEEEccTTccccccEEEEEEEcccHHHHHHHHHHHHHHHccccEEEEETTEEEEEccTTEEEHHHHHTccccTTccccTTHHcccHHHHHHHHHHHHHHHHHHHHHHHHHTcccccGGGEEEETccEEEcccccccccccccHHHHHHTTcHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHccccTTTTTHHHHHHTTTTccHHHHHHHHHHHHHHHHHHTTHHHHHHHHHTTHHHHH DISOP:02AL 1-3| PSIPRED cEEcccEEcccEEEEEEEEccccEEEEEEEEccccEEEEEEccHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccEEEEEEEEccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEEcccEEEEEccHHHHcccccEEEEEEccHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccHHHHHHHHHHccccHHHccccHHHHHHHccc //