[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81351.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81351.1 GT:GENE AAS81351.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(987492..987866) GB:FROM 987492 GB:TO 987866 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81351.1 GB:DB_XREF GI:46196936 LENGTH 124 SQ:AASEQ MRRVSSLTWSEVLGYHRTRKGIGGRSLLVDRGESGYRNRFLPDGRILYMGEGKRGDQEPVGGNLRLLLAHREGTPLRVFLRERPGVWRDLGCYRVEGWRYALLEEEGRWVYWFTLAPGGCGEAP GT:EXON 1|1-124:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 56-57, 121-124| PSIPRED ccccccccHHHHHHHHHHcccccccEEEEEccccccccccccccEEEEEEcccccccccccccEEEEEEEcccccEEEEEEccccccccccEEEEccEEEEEEEccccEEEEEEEccccccccc //