[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81367.1
DDBJ      :             GTP-binding protein
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  910/915 : Eukaryota  159/199 : Viruses  0/175   --->[See Alignment]
c.37.1d.52.5
:431 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->161 2dykA PDBj 4e-73 100.0 %
:BLT:PDB   173->288 1xzqA PDBj 1e-23 47.0 %
:RPS:PDB   1->165 3a1tA PDBj 6e-24 33.7 %
:RPS:PDB   174->431 3a1tA PDBj 1e-31 28.0 %
:RPS:SCOP  3->193 1h65A  c.37.1.8 * 7e-20 13.1 %
:RPS:SCOP  174->338 1zd9A1  c.37.1.8 * 2e-20 14.5 %
:RPS:SCOP  346->429 1mkyA3  d.52.5.1 * 1e-22 30.0 %
:HMM:SCOP  2->160 1wxqA1 c.37.1.8 * 5.8e-45 43.7 %
:HMM:SCOP  135->432 1f5nA2 c.37.1.8 * 4.4e-62 40.4 %
:RPS:PFM   13->113 PF01926 * MMR_HSR1 3e-12 41.6 %
:RPS:PFM   174->337 PF02421 * FeoB_N 8e-14 34.8 %
:HMM:PFM   13->117 PF01926 * MMR_HSR1 9.3e-25 41.9 105/108  
:HMM:PFM   185->290 PF01926 * MMR_HSR1 2.4e-23 38.1 105/108  
:HMM:PFM   252->333 PF10662 * PduV-EutP 0.001 27.6 76/143  
:BLT:SWISS 1->423 ENGA_DEIGD e-138 56.2 %
:REPEAT 2|3->119|175->292
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81367.1 GT:GENE AAS81367.1 GT:PRODUCT GTP-binding protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1002876..1004171 GB:FROM 1002876 GB:TO 1004171 GB:DIRECTION + GB:PRODUCT GTP-binding protein GB:PROTEIN_ID AAS81367.1 GB:DB_XREF GI:46196952 LENGTH 431 SQ:AASEQ MHKVVIVGRPNVGKSSLFNRLLKKRSAVVADVPGVTRDLKEGVVETDRGRFLLVDTGGLWSGDKWEKKIQEKVDRALEDAEVVLFAVDGRAELTQADYEVAEYLRRKGKPVILVATKVDDPKHELYLGPLYGLGFGDPIPTSSEHARGLEELLEAIWERLPVRQIETEPEVAGIRLAIVGRPNAGKSSLLNAILGEERVIVSEEPGTTRDAIDVEFFFGGQRFVLVDTAGIRKRPESLVEELAIRRSLRAMDEADVVLLVVDPFQVGDRELKLANEALDRGKPVLLVITKWDLVDKEDAPKMRRLLREKLAHLDHLPRVFTSALTRQNLDRIFREAVRLHELNQTRVPTAELNRWVAVWTSRVQMPNFKGKPLKILYATQPEVAPPTFVFFVNHPEFVTRAFENYLKNRIGEDLGLREVPFRLVFRGRREE GT:EXON 1|1-431:0| BL:SWS:NREP 1 BL:SWS:REP 1->423|ENGA_DEIGD|e-138|56.2|422/441| NREPEAT 1 REPEAT 2|3->119|175->292| SEG 125->136|lylgplyglgfg| BL:PDB:NREP 2 BL:PDB:REP 1->161|2dykA|4e-73|100.0|150/150| BL:PDB:REP 173->288|1xzqA|1e-23|47.0|115/449| RP:PDB:NREP 2 RP:PDB:REP 1->165|3a1tA|6e-24|33.7|162/254| RP:PDB:REP 174->431|3a1tA|1e-31|28.0|239/254| RP:PFM:NREP 2 RP:PFM:REP 13->113|PF01926|3e-12|41.6|101/105|MMR_HSR1| RP:PFM:REP 174->337|PF02421|8e-14|34.8|155/188|FeoB_N| HM:PFM:NREP 3 HM:PFM:REP 13->117|PF01926|9.3e-25|41.9|105/108|MMR_HSR1| HM:PFM:REP 185->290|PF01926|2.4e-23|38.1|105/108|MMR_HSR1| HM:PFM:REP 252->333|PF10662|0.001|27.6|76/143|PduV-EutP| GO:PFM:NREP 6 GO:PFM GO:0005525|"GO:GTP binding"|PF01926|IPR002917| GO:PFM GO:0005622|"GO:intracellular"|PF01926|IPR002917| GO:PFM GO:0005525|"GO:GTP binding"|PF02421|IPR011619| GO:PFM GO:0015093|"GO:ferrous iron transmembrane transporter activity"|PF02421|IPR011619| GO:PFM GO:0015684|"GO:ferrous iron transport"|PF02421|IPR011619| GO:PFM GO:0016021|"GO:integral to membrane"|PF02421|IPR011619| RP:SCP:NREP 3 RP:SCP:REP 3->193|1h65A|7e-20|13.1|191/257|c.37.1.8| RP:SCP:REP 174->338|1zd9A1|2e-20|14.5|159/164|c.37.1.8| RP:SCP:REP 346->429|1mkyA3|1e-22|30.0|80/81|d.52.5.1| HM:SCP:REP 2->160|1wxqA1|5.8e-45|43.7|158/0|c.37.1.8|1/2|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 135->432|1f5nA2|4.4e-62|40.4|267/0|c.37.1.8|2/2|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2831 OP:NHOMOORG 1082 OP:PATTERN ---111-----------------------------12------------1----2122111------- 3332122122123111111-12111211111121111222122222212221222222113211222221221222222223232453565534442223333323233322222222222222234333333333344431113133333322333233333323333231333333323333333343233333333333333333333333333333343333333333333333332233333333323333433433333333333332223333333333333333333333333333333333333333333333345343333333444344444333543242333433455443344444433243222222222223323333333333333333322-22232332333232233223332332223232222222233333333333223332232222233223333333333333222313333322223333433333333333333333333333322333223333333333333433333322233333333233243244334422344544455223232443333333232332333333334334334433233333333333334443324223333-4333222222233333333333333333-33333333333333333333333333333332233223333333333333332333333333333223233333333333332333333333223333333333333343333333333333333333333333332333333333333333332322334333333322222223332232233333333-33332222222322333334433353555222 11--2311311----11111111111111111111111111111111111111111111111111111111111111-1111111111-1311111----111221-2422111111-------11-1-282--12--1-1-11--11----1-1---113-1211-111111213444M5445542241443442323 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 431 STR:RPRED 100.0 SQ:SECSTR TTTcccccHHHHHHHHcHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHcccGGGccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHGGGccccccccccHcEEEEEEccTTccHHHHHHHHHTcTcEEEEEcTTcccEEEEEEEEETTEEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEEEEcccHcHHHHHHHHHHHHTTccEEEEEEcHHHHHHTTHHHHccccHHHHHHHHcccEEEccTTTcTTHHHHHHHHHHHHHcccccccccHccccHHHHHHHHHHHHHHHHHHTTHTTccccccHHHHHHHTTcTTHHHHHHHTTcccccHHccHHHHHHHHHHHHHHHHH DISOP:02AL 428-431| PSIPRED cEEEEEEEcccccHHHHHHHHHccccEEEccccccEEEEEEEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHcccEEEEccccccEEEEEEEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccEEEEEEEEEccccccEEEEEEcccccccHHHHHHHHHHHHHHccccccEEEEEEEEcccc //