[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81373.1
DDBJ      :             SSU ribosomal protein S20P
Swiss-Prot:RS20_THET2   RecName: Full=30S ribosomal protein S20;

Homologs  Archaea  0/68 : Bacteria  144/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.7.6
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->106 2uxcT PDBj 8e-50 100.0 %
:RPS:PDB   7->87 3bbnT PDBj 3e-07 48.1 %
:RPS:SCOP  8->106 1fjgT  a.7.6.1 * 3e-15 100.0 %
:HMM:SCOP  8->106 1fjgT_ a.7.6.1 * 2.8e-22 46.5 %
:HMM:PFM   9->89 PF01649 * Ribosomal_S20p 1.1e-20 48.1 81/84  
:BLT:SWISS 1->106 RS20_THET2 2e-53 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81373.1 GT:GENE AAS81373.1 GT:PRODUCT SSU ribosomal protein S20P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1008089..1008409) GB:FROM 1008089 GB:TO 1008409 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S20P GB:PROTEIN_ID AAS81373.1 GB:DB_XREF GI:46196958 LENGTH 106 SQ:AASEQ MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA GT:EXON 1|1-106:0| SW:ID RS20_THET2 SW:DE RecName: Full=30S ribosomal protein S20; SW:GN Name=rpsT; Synonyms=rps20; OrderedLocusNames=TT_C1031; SW:KW 3D-structure; Complete proteome; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->106|RS20_THET2|2e-53|100.0|106/106| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 8->106|2uxcT|8e-50|100.0|99/99| RP:PDB:NREP 1 RP:PDB:REP 7->87|3bbnT|3e-07|48.1|81/102| HM:PFM:NREP 1 HM:PFM:REP 9->89|PF01649|1.1e-20|48.1|81/84|Ribosomal_S20p| RP:SCP:NREP 1 RP:SCP:REP 8->106|1fjgT|3e-15|100.0|99/99|a.7.6.1| HM:SCP:REP 8->106|1fjgT_|2.8e-22|46.5|99/99|a.7.6.1|1/1|Ribosomal protein S20| OP:NHOMO 149 OP:NHOMOORG 147 OP:PATTERN -------------------------------------------------------------------- ----------------------111------1---------1-1--1--------1----111111----1--------------1--------------------------------------------------111---------1----11--------1---11111---1-1----11111111---1--------1------1----1---111--11---------------------------------------------------------------------------------------------------------------------------1-1----1--111---11----1---11---------------------------------------------1---------------------------11111111---------------------1---------------------11111-----------------------------------------------------1111111-------1-1-1-1---11------------------1-------------------------11------1-----11111--111111-111------1---------1------------------------------------------------------------------------------------111111111-------------------------------------------------111111111----1--------------------------1-------111111111---------------------------11-1111111--- ------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------2------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 94.3 SQ:SECSTR ######cccccccHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHTTccccccccTTHHHHHHHHHTTHHHHHTTTTccccccccccc DISOP:02AL 1-18, 105-106| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccc //