[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81376.1
DDBJ      :             cytochrome complex Fe-S subunit, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.33.1
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   82->173 1nykA PDBj 7e-06 50.6 %
:RPS:PDB   1->142 2e76D PDBj 1e-05 21.2 %
:RPS:SCOP  70->173 1nykA  b.33.1.1 * 2e-11 32.6 %
:HMM:SCOP  57->171 1jm1A_ b.33.1.1 * 6.2e-19 29.8 %
:HMM:PFM   92->160 PF00355 * Rieske 2.1e-10 38.6 57/97  
:BLT:SWISS 63->151 ARSS_HERAR 3e-07 34.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81376.1 GT:GENE AAS81376.1 GT:PRODUCT cytochrome complex Fe-S subunit, putative GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1010219..1010773) GB:FROM 1010219 GB:TO 1010773 GB:DIRECTION - GB:PRODUCT cytochrome complex Fe-S subunit, putative GB:PROTEIN_ID AAS81376.1 GB:DB_XREF GI:46196961 LENGTH 184 SQ:AASEQ MKRRDLVFYLPVAVAGGFFAWFGVRTYNLRFRPRPEAGTPTWKAGPRVAVARLGELGVWQARPFLYPLPLGELKAFLLRLPEPAPGGLSVGEEHYLALSRICTHQGCTVNFVPDPEAASLLYNFRYERPFLGCPCHFGAFDPLLGGKAVYGPPRFPLPRLRLEAEGETLYATGHEVPLRPMEGG GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 63->151|ARSS_HERAR|3e-07|34.7|75/173| TM:NTM 1 TM:REGION 6->25| SEG 152->162|pprfplprlrl| BL:PDB:NREP 1 BL:PDB:REP 82->173|1nykA|7e-06|50.6|79/156| RP:PDB:NREP 1 RP:PDB:REP 1->142|2e76D|1e-05|21.2|118/168| HM:PFM:NREP 1 HM:PFM:REP 92->160|PF00355|2.1e-10|38.6|57/97|Rieske| RP:SCP:NREP 1 RP:SCP:REP 70->173|1nykA|2e-11|32.6|92/156|b.33.1.1| HM:SCP:REP 57->171|1jm1A_|6.2e-19|29.8|114/202|b.33.1.1|1/1|ISP domain| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 97.3 SQ:SECSTR GGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccTTccccccccccccTHHHHTTcccccccccccGGGccEEccccTTcccccccGGGcccccccEEcccccccccccEETTTTEEcTcEEcETTTEEEEcTTTccEEETTTTccEEEcccccccccccEEEccccEEEEcTccccc##### DISOP:02AL 35-41, 181-184| PSIPRED cccEEEEEHHHHHHHHHHHHHHHHEEcccccccccccccccccccccEEEEEHHccccccccEEEEEcccccccEEEEEccccccccEEEccccEEEEEccccccccccccccccccccccccccccccEEEEcccccEEccccccEEEEccccccccEEEEEEEccEEEEEEccccccccccc //