[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81395.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.3.1
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   84->175 1h32B PDBj 3e-06 43.7 %
:RPS:PDB   56->175 1dw0A PDBj 2e-12 20.4 %
:RPS:PDB   148->186 1dj2A PDBj 2e-05 17.9 %
:RPS:SCOP  79->175 1h31A2  a.3.1.8 * 2e-10 11.8 %
:HMM:SCOP  1->179 1h32B_ a.3.1.1 * 4.6e-16 35.7 %
:HMM:PFM   98->175 PF00034 * Cytochrom_C 8.7e-07 24.7 73/91  
:BLT:SWISS 65->182 Y1806_AQUAE 2e-29 53.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81395.1 GT:GENE AAS81395.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1025435..1026007) GB:FROM 1025435 GB:TO 1026007 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81395.1 GB:DB_XREF GI:46196980 LENGTH 190 SQ:AASEQ MRKVLVALFALALAFALAQRYFTEEELKRIETGGKAYAEVFVGQRPDQALCSIHRNRLPADLLPKFLEEQRALIKYPASGKLMGDWRKGGAIFNDLRKANCFSCHFGSPEHLGGDVGPSLEKYGLKRGQSEAVQRYTYEVIYNSWAYFPCTVMYRFGAQGLLTPEEIADVVAYLLDPESDFNTKPAVGSK GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 65->182|Y1806_AQUAE|2e-29|53.5|114/206| TM:NTM 1 TM:REGION 4->26| SEG 4->18|vlvalfalalafala| BL:PDB:NREP 1 BL:PDB:REP 84->175|1h32B|3e-06|43.7|87/134| RP:PDB:NREP 2 RP:PDB:REP 56->175|1dw0A|2e-12|20.4|108/112| RP:PDB:REP 148->186|1dj2A|2e-05|17.9|39/429| HM:PFM:NREP 1 HM:PFM:REP 98->175|PF00034|8.7e-07|24.7|73/91|Cytochrom_C| RP:SCP:NREP 1 RP:SCP:REP 79->175|1h31A2|2e-10|11.8|93/111|a.3.1.8| HM:SCP:REP 1->179|1h32B_|4.6e-16|35.7|115/0|a.3.1.1|1/1|Cytochrome c| OP:NHOMO 33 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------22-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111-------------------------------------1---------------------------------------------------------------------------------------------11111111111-----1---11-------------------1------------------------11-1-------------------------------------------------------------------4-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 70.0 SQ:SECSTR #######################################################cccHHHHHHHHHHHHTccccHHHHHHHHHcccccccTTHHTTcccTHHHHcccccccTTccEEcTccEEccccTTTcTTTTcHcHHHHHHHHHHHHHHGGcHHcccccHHHHHHHHHHHHcTTccccTTcTTc## DISOP:02AL 23-36, 183-190| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccEEEEEccccccccccccccHHHHHHcccccHHHHHHHHHHHHcHHHcccccccccccccccccHHHHHHHHHHHcccccccccccccccc //