[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81400.1
DDBJ      :             cytochrome c-552 precursor
Swiss-Prot:CY552_THET8  RecName: Full=Cytochrome c-552;AltName: Full=Cytochrome c552;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.3.1
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->148 1qyzA PDBj 6e-69 97.6 %
:RPS:PDB   23->148 1c52A PDBj 2e-21 97.6 %
:RPS:SCOP  23->148 1c52A  a.3.1.1 * 1e-21 97.6 %
:HMM:SCOP  19->142 1c52A_ a.3.1.1 * 4.6e-26 32.3 %
:HMM:PFM   19->106 PF00034 * Cytochrom_C 6.9e-11 24.4 86/91  
:HMM:PFM   2->16 PF08802 * CytB6-F_Fe-S 0.00095 60.0 15/39  
:BLT:SWISS 1->148 CY552_THET8 1e-68 98.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81400.1 GT:GENE AAS81400.1 GT:PRODUCT cytochrome c-552 precursor GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1028239..1028685 GB:FROM 1028239 GB:TO 1028685 GB:DIRECTION + GB:PRODUCT cytochrome c-552 precursor GB:PROTEIN_ID AAS81400.1 GB:DB_XREF GI:46196985 LENGTH 148 SQ:AASEQ MKRTLMALLLLGGLALAQADGAKIYAQCAGCHQQNGQGIPAVFPPLAGHVAEILAKEGGREYLILVLLYGLQGQIEVKGVKYNGVMSSFAQLKDEEIAAVLNHIATAWGDAKKVKGFKPFTAEEVKKLRAKKLTPQQVLAERKKLGLK GT:EXON 1|1-148:0| SW:ID CY552_THET8 SW:DE RecName: Full=Cytochrome c-552;AltName: Full=Cytochrome c552;Flags: Precursor; SW:GN Name=cycA; OrderedLocusNames=TTHA1423; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;Electron transport; Heme; Iron; Metal-binding;Pyrrolidone carboxylic acid; Signal; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->148|CY552_THET8|1e-68|98.0|148/148| GO:SWS:NREP 3 GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006810|"GO:transport"|Transport| SEG 5->22|lmallllgglalaqadga| BL:PDB:NREP 1 BL:PDB:REP 23->148|1qyzA|6e-69|97.6|126/130| RP:PDB:NREP 1 RP:PDB:REP 23->148|1c52A|2e-21|97.6|126/131| HM:PFM:NREP 2 HM:PFM:REP 19->106|PF00034|6.9e-11|24.4|86/91|Cytochrom_C| HM:PFM:REP 2->16|PF08802|0.00095|60.0|15/39|CytB6-F_Fe-S| RP:SCP:NREP 1 RP:SCP:REP 23->148|1c52A|1e-21|97.6|126/131|a.3.1.1| HM:SCP:REP 19->142|1c52A_|4.6e-26|32.3|124/131|a.3.1.1|1/1|Cytochrome c| OP:NHOMO 106 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------1-221-51---------------------------------------------------------------------------1-22-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-22----------------------------------------------------------1-------------22222222-112-----------------------------------12-1-----211111-111122-21111-21---1-2--212---1--111------1111---------1-1--1----------------------------1------------------------------------1-1-----------------------------------------------------------------------------------------------------------------------2-----------------------------------------11-1-1---------------------------------------1-------------11--------------------------------------------------31- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 85.1 SQ:SECSTR ######################HHTHHHHHHHcTTccccTTTccccTTHHHHHHTcTTHHHHHHHHHHHcEEEEEEETTEEEEEEEcccTTccHHHHHHHHHHHHHTTcTGGGcTTcccccHHHHHHHTTccccHHHHHHHHHTTccc DISOP:02AL 146-148| PSIPRED cHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccccHHHccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccHHHHHHHHcccccc //