[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81408.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  68/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.230.2
:69 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->69 2cz8D PDBj 3e-28 100.0 %
:RPS:PDB   2->69 2cz8D PDBj 4e-20 85.3 %
:RPS:SCOP  4->69 1mogA  d.230.2.1 * 1e-16 33.3 %
:HMM:SCOP  4->70 1mogA_ d.230.2.1 * 5.1e-23 59.7 %
:RPS:PFM   4->67 PF07311 * DUF1458 2e-09 48.4 %
:HMM:PFM   3->68 PF07311 * DUF1458 1.3e-31 63.6 66/66  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81408.1 GT:GENE AAS81408.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1036731..1036940 GB:FROM 1036731 GB:TO 1036940 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81408.1 GB:DB_XREF GI:46196993 LENGTH 69 SQ:AASEQ MGKVYKKVELVGTSEEGLEAAIQAALARARKTLRHLDWFEVKEIRGTIGEAGVKEYQVVLEVGFRLEET GT:EXON 1|1-69:0| SEG 20->29|aaiqaalara| BL:PDB:NREP 1 BL:PDB:REP 2->69|2cz8D|3e-28|100.0|68/68| RP:PDB:NREP 1 RP:PDB:REP 2->69|2cz8D|4e-20|85.3|68/68| RP:PFM:NREP 1 RP:PFM:REP 4->67|PF07311|2e-09|48.4|64/66|DUF1458| HM:PFM:NREP 1 HM:PFM:REP 3->68|PF07311|1.3e-31|63.6|66/66|DUF1458| RP:SCP:NREP 1 RP:SCP:REP 4->69|1mogA|1e-16|33.3|66/67|d.230.2.1| HM:SCP:REP 4->70|1mogA_|5.1e-23|59.7|67/67|d.230.2.1|1/1|Flavin-binding protein dodecin| OP:NHOMO 69 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- -----------------11-1---1-111111--------1-----------111-------1----11---------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1--2------------1---11-------------------------------------------------------------------1111------------------------------111----------------1-------------11-----------------1--111-11111--1--------------------------------1-1---1----------------------111---------------------------------------------------------------------------------------------------11-11-1---------------------------1-1111-11-1-1-1-1-------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 98.6 SQ:SECSTR #cccEEEEEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEETTEEEEEEEEEEEEEEcccc DISOP:02AL 1-2, 68-69| PSIPRED ccEEEEEEEEEEEccccHHHHHHHHHHHHHcccccccEEEEEEEEEEEEcccEEEEEEEEEEEEEEccc //