[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81409.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.110.1
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->148 2yskA PDBj 4e-81 100.0 %
:RPS:SCOP  12->101 1b25A1  a.110.1.1 * 5e-07 21.2 %
:RPS:PFM   22->144 PF10025 * DUF2267 1e-25 57.5 %
:HMM:PFM   18->144 PF10025 * DUF2267 2.1e-44 52.4 124/125  
:REPEAT 2|14->76|82->148

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81409.1 GT:GENE AAS81409.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1037001..1037447 GB:FROM 1037001 GB:TO 1037447 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81409.1 GB:DB_XREF GI:46196994 LENGTH 148 SQ:AASEQ MRPVSATGLEVFDRTLHKTHAWLKAIMEELGTEDRHKAYLALRAVLHALRDRLTVEEVAQLAAQLPMLVRGLYYEGWDPTGKPLKERHKEAFLAHVAEELKTPSGPAVDPEAATRAVFKVLSREISQGELEDVLGLLPKELRALWPQG GT:EXON 1|1-148:0| NREPEAT 1 REPEAT 2|14->76|82->148| BL:PDB:NREP 1 BL:PDB:REP 5->148|2yskA|4e-81|100.0|144/144| RP:PFM:NREP 1 RP:PFM:REP 22->144|PF10025|1e-25|57.5|120/125|DUF2267| HM:PFM:NREP 1 HM:PFM:REP 18->144|PF10025|2.1e-44|52.4|124/125|DUF2267| RP:SCP:NREP 1 RP:SCP:REP 12->101|1b25A1|5e-07|21.2|85/401|a.110.1.1| OP:NHOMO 29 OP:NHOMOORG 28 OP:PATTERN ---------------------------------------------------1---------------- --------------------------------1----------1-----------------1---11----------------1-111------------------------------------1------------------------1------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----1--11-------------------------1--21-------------1---------1-------------1-------------------------------------------------------------------------------------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 97.3 SQ:SECSTR ####cccccHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHTTccHHHHHHHHTTccHHHHHHHHTTccTTccccccccHHHHHHHHHHTcEETTEEcccHHHHHHHHHHHHHHHccHHHHHHHHHTccHHHHTTcTTc DISOP:02AL 1-6| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHcccc //