[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81418.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:329 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   140->276 PF04087 * DUF389 5.6e-40 48.2 137/139  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81418.1 GT:GENE AAS81418.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1045987..1046976) GB:FROM 1045987 GB:TO 1046976 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81418.1 GB:DB_XREF GI:46197003 LENGTH 329 SQ:AASEQ MPLRVLLFAVPEKDEEAVAALLAEAGPWAAWRSREGGEVLYHVFLEAGQVEPVSDALQNRFGKALRLAVLPVEAVVPPPEEAKPPEEKPSPERVSREELYQELSEASEAGGVYLALVALATLVAAVGLVKGSAALVIGAMVIAPLLGPAMALALGSALGDLDLFRKAFRTLLLGVALASGLSLALGFFLPVDPSAPELAPRTRPGLEDVAVALAAGVAGALGFTTGAPAALVGVMVAVALLPPLTAAGLLSGAGYPEKAFGAVLLFAVNVASVNLAGVATFLLQRVRPRTFWEAERAARASRTALLLWGLSLALLAGLLYLAQRVLPGF GT:EXON 1|1-329:0| TM:NTM 7 TM:REGION 107->129| TM:REGION 137->159| TM:REGION 172->194| TM:REGION 204->226| TM:REGION 232->254| TM:REGION 261->283| TM:REGION 303->325| SEG 15->31|eeavaallaeagpwaaw| SEG 71->98|pveavvpppeeakppeekpspervsree| SEG 109->129|aggvylalvalatlvaavglv| SEG 143->163|apllgpamalalgsalgdldl| SEG 171->189|lllgvalasglslalgffl| SEG 209->222|vavalaagvagalg| SEG 226->254|gapaalvgvmvavallppltaagllsgag| SEG 294->322|aeraarasrtalllwglslallagllyla| HM:PFM:NREP 1 HM:PFM:REP 140->276|PF04087|5.6e-40|48.2|137/139|DUF389| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------------------------------------1------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 77-96| PSIPRED cccEEEEEEccccccHHHHHHHHHcccEEEEccccccEEEEEEEcccccHHHHHHHHHHHcccccEEEEEcEEEcccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //