[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81431.1
DDBJ      :             succinate dehydrogenase iron-sulfur protein
Swiss-Prot:             

Homologs  Archaea  54/68 : Bacteria  641/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
a.1.2d.15.4
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->228 1nekB PDBj 4e-53 45.4 %
:RPS:PDB   2->229 2bs2B PDBj 5e-34 28.9 %
:RPS:SCOP  1->102 1kf6B2  d.15.4.2 * 1e-20 35.3 %
:RPS:SCOP  106->229 1e7pB1  a.1.2.1 * 2e-32 22.6 %
:HMM:SCOP  1->102 1kf6B2 d.15.4.2 * 5.9e-33 49.0 %
:HMM:SCOP  103->232 1nekB1 a.1.2.1 * 3.8e-35 33.8 %
:HMM:PFM   143->156 PF00037 * Fer4 8.5e-05 57.1 14/24  
:HMM:PFM   24->78 PF00111 * Fer2 0.00022 36.0 50/77  
:BLT:SWISS 3->230 DHSB_COXBU 6e-56 44.1 %
:PROS 144->155|PS00198|4FE4S_FER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81431.1 GT:GENE AAS81431.1 GT:PRODUCT succinate dehydrogenase iron-sulfur protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1058027..1058725) GB:FROM 1058027 GB:TO 1058725 GB:DIRECTION - GB:PRODUCT succinate dehydrogenase iron-sulfur protein GB:PROTEIN_ID AAS81431.1 GB:DB_XREF GI:46197016 LENGTH 232 SQ:AASEQ MQVTLKVLRFDPAKDKKPRWETYQVEAEPWDRVLDLLHKVKWYQDGSLAFRRSCGHGICGSDAMLINGKNRLACKTLVRDLGNVITVEPIRGLPVEKDLIVDMEPFFAAYRAVKPYLINDEPPPQRERLQSPEERERFDQGTKCILCASCTTSCPVFWVNGTYIGPAAIVQAHRFIFDSRDRGKRERFQVLGSGGGVWRCRTAYNCTEACPRDIPVTQLIEEVKRAILMDRF GT:EXON 1|1-232:0| BL:SWS:NREP 1 BL:SWS:REP 3->230|DHSB_COXBU|6e-56|44.1|227/235| PROS 144->155|PS00198|4FE4S_FER_1|PDOC00176| BL:PDB:NREP 1 BL:PDB:REP 1->228|1nekB|4e-53|45.4|227/238| RP:PDB:NREP 1 RP:PDB:REP 2->229|2bs2B|5e-34|28.9|228/239| HM:PFM:NREP 2 HM:PFM:REP 143->156|PF00037|8.5e-05|57.1|14/24|Fer4| HM:PFM:REP 24->78|PF00111|0.00022|36.0|50/77|Fer2| RP:SCP:NREP 2 RP:SCP:REP 1->102|1kf6B2|1e-20|35.3|102/105|d.15.4.2| RP:SCP:REP 106->229|1e7pB1|2e-32|22.6|124/133|a.1.2.1| HM:SCP:REP 1->102|1kf6B2|5.9e-33|49.0|102/105|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 103->232|1nekB1|3.8e-35|33.8|130/0|a.1.2.1|1/1|alpha-helical ferredoxin| OP:NHOMO 1200 OP:NHOMOORG 882 OP:PATTERN 11-1-1111111111111212111111111111111111111111111-1---1-------1111-11 -2-131--------22233-321122333332222221431111121-1111111111--112222233111111111-112122222------------------1-1-11111111111111111111211132--------111111111-1--------12111111------------11111---1111111111111111111111111111111111------1111111111111111111111---------------------------------------------------------------------------------------11---------2--1111-12---2---------11111111111121111111111111111111111-11111212111111111111111111111122212211111111111111-11111121111111111111111111111111111111-111121221212222244122222-2121111111231111111111222121-1-221111111111212-211-111121222-----1--------11-31221122221111111111122323--221111111122333313222232222322--11121------22222212222222222-221222222222222222222222222222222222222222222222222212222222222221111111111111111111111111111111111111111111111111111111111111111111111112222222222222211111111111111--1-----------------------------------------------------1-- 11--111-522-11111111111111111111111111111111111111111111111111111111112111111-1111111111-111111121111-1212-11-1242211111112111131161-11211111111-11111111111211-2311112211211211111K1111112821361122121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 230 STR:RPRED 99.1 SQ:SECSTR cEEEEEEEEccTTcTTccEEEEEEEEccTTccHHHHHHHHHHHTcTTcccccccccccccTTEEEETTEEEEGGGccGGGcTcEEEEEccTTcEEEETTEEEcHHHHHHHHHHTTcccccccTTcccccccHHHHHHHHHHHTcccccHHHHTcHHHHHcTTccHHHHHHHHHHHHTcTTccccHHHHHHHccTTTGGGcccccHHHHHcTTcccHHHHHHHHHHHHTTc## DISOP:02AL 123-131| PSIPRED cEEEEEEEEEcccccccccEEEEEEEccccccHHHHHHHHHHHccccEEEcccccccccccEEEEEccEEcHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccEEEcccccccHHHHHHHHHHHccccccHHHHHHHHHcccccHHHccccccHHHHccccccHHHHHHHHHHHHHHHcc //