[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81443.1
DDBJ      :             LSU ribosomal protein L13P
Swiss-Prot:RL13_THET8   RecName: Full=50S ribosomal protein L13;

Homologs  Archaea  14/68 : Bacteria  909/915 : Eukaryota  156/199 : Viruses  0/175   --->[See Alignment]
c.21.1
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->163 2hguM PDBj 2e-80 100.0 %
:RPS:PDB   25->161 3d5bN PDBj 6e-43 100.0 %
:RPS:SCOP  25->161 1vs6J1  c.21.1.1 * 6e-53 55.5 %
:HMM:SCOP  36->163 1j3aA_ c.21.1.1 * 8e-46 58.6 %
:RPS:PFM   36->161 PF00572 * Ribosomal_L13 7e-35 60.3 %
:HMM:PFM   36->162 PF00572 * Ribosomal_L13 2.8e-57 63.8 127/128  
:BLT:SWISS 24->163 RL13_THET8 4e-80 99.3 %
:PROS 126->148|PS00783|RIBOSOMAL_L13

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81443.1 GT:GENE AAS81443.1 GT:PRODUCT LSU ribosomal protein L13P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1068267..1068758) GB:FROM 1068267 GB:TO 1068758 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L13P GB:PROTEIN_ID AAS81443.1 GB:DB_XREF GI:46197028 LENGTH 163 SQ:AASEQ MVKSSLAFLRGPPIPRQEQRRALVKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV GT:EXON 1|1-163:0| SW:ID RL13_THET8 SW:DE RecName: Full=50S ribosomal protein L13; SW:GN Name=rplM; OrderedLocusNames=TTHA1465; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;Ribonucleoprotein; Ribosomal protein. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 24->163|RL13_THET8|4e-80|99.3|140/140| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 126->148|PS00783|RIBOSOMAL_L13|PDOC00625| BL:PDB:NREP 1 BL:PDB:REP 25->163|2hguM|2e-80|100.0|139/139| RP:PDB:NREP 1 RP:PDB:REP 25->161|3d5bN|6e-43|100.0|137/137| RP:PFM:NREP 1 RP:PFM:REP 36->161|PF00572|7e-35|60.3|126/128|Ribosomal_L13| HM:PFM:NREP 1 HM:PFM:REP 36->162|PF00572|2.8e-57|63.8|127/128|Ribosomal_L13| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00572|IPR005822| GO:PFM GO:0005622|"GO:intracellular"|PF00572|IPR005822| GO:PFM GO:0005840|"GO:ribosome"|PF00572|IPR005822| GO:PFM GO:0006412|"GO:translation"|PF00572|IPR005822| RP:SCP:NREP 1 RP:SCP:REP 25->161|1vs6J1|6e-53|55.5|137/140|c.21.1.1| HM:SCP:REP 36->163|1j3aA_|8e-46|58.6|116/142|c.21.1.1|1/1|Ribosomal protein L13| OP:NHOMO 1139 OP:NHOMOORG 1079 OP:PATTERN ----1---1111111--------1-----------------------------11-111--------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111121111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 1---111-31--211-111-11111111111-1111-111111111111111111111-1111111111111111-111111111111-11111111111111112-141-111-121---11111-1-121-1-11---1-11111-111-11---1211--2---------112222M2222242541321121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 85.9 SQ:SECSTR #######################cccccccccccccEEEccTTccHHHHHHHHHHHHTGGGcTTccTTTcccccEEEcccTTccccccTTTTcEEEcccccTTcccEEEHHHHHHccTHHHHHHHHHHHccccHHHHHHHHTEEEcccccccccccccEEccc DISOP:02AL 1-4, 12-24| PSIPRED ccccccHHHccccccccccccEEEEEEcccccccEEEEEEcccccHHHHHHHHHHHHHcccccccccccccccEEEEEEccEEEEEccHHHEEEEEEEcccccccccccHHHHHcccHHHHHHHHHHHcccccHHHHHHHHccEEcccccccccccccEEEcc //