[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81452.1
DDBJ      :             hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  106/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.51.1
:210 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   45->93 2o7lA PDBj 8e-04 40.9 %
:RPS:SCOP  56->198 2ic8A1  f.51.1.1 * 5e-09 19.1 %
:HMM:SCOP  9->212 2nr9A1 f.51.1.1 * 1.2e-43 45.0 %
:RPS:PFM   56->197 PF01694 * Rhomboid 1e-09 34.1 %
:HMM:PFM   55->207 PF01694 * Rhomboid 1.8e-40 44.4 142/146  
:BLT:SWISS 45->93 GLPG_SALAR 9e-05 45.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81452.1 GT:GENE AAS81452.1 GT:PRODUCT hypothetical membrane spanning protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1081706..1082338) GB:FROM 1081706 GB:TO 1082338 GB:DIRECTION - GB:PRODUCT hypothetical membrane spanning protein GB:PROTEIN_ID AAS81452.1 GB:DB_XREF GI:46197037 LENGTH 210 SQ:AASEQ MIPLHDINPARRPALVVRSLVVLNVAAFLLELLLGPTQVVAKMGFVPALFFQDPLGEGYRILTSMFLHGGLFHLLSNMWFLWVFGDNVEDRMGGERFLLFYLLGGVAAALAQALFMPASTVPMIGASGAVSAVLGAYYVLFPRAYVITLVWFVLPFTLALPAGFYLGYWAFLQLVQGLLGVPGIAFWAHLGGFVFGVAAVRAFLPRRWRW GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 45->93|GLPG_SALAR|9e-05|45.5|44/276| TM:NTM 4 TM:REGION 16->38| TM:REGION 94->116| TM:REGION 134->156| TM:REGION 178->200| SEG 20->34|lvvlnvaafllelll| SEG 97->118|fllfyllggvaaalaqalfmpa| SEG 125->136|gasgavsavlga| SEG 172->181|lqlvqgllgv| BL:PDB:NREP 1 BL:PDB:REP 45->93|2o7lA|8e-04|40.9|44/175| RP:PFM:NREP 1 RP:PFM:REP 56->197|PF01694|1e-09|34.1|132/146|Rhomboid| HM:PFM:NREP 1 HM:PFM:REP 55->207|PF01694|1.8e-40|44.4|142/146|Rhomboid| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF01694|IPR002610| GO:PFM GO:0016021|"GO:integral to membrane"|PF01694|IPR002610| RP:SCP:NREP 1 RP:SCP:REP 56->198|2ic8A1|5e-09|19.1|131/182|f.51.1.1| HM:SCP:REP 9->212|2nr9A1|1.2e-43|45.0|189/0|f.51.1.1|1/1|Rhomboid-like| OP:NHOMO 121 OP:NHOMOORG 113 OP:PATTERN --1---------------11111-----------------------------------------1--- -11-1-----------------------------------11-1-----------------------12--------------1--11------------------------------------------------11111---112121---11-----------1221----------------11-1-------------------------------------------------------------------------------------------------------------------------------------1---------------------------1---1--1111-11-111----111-------------1----------------------------111-----112--111-1---11-1111111---------------1-----------------------------------------------------------------------------------------------------------111-111-11111-----11-111121111---------------------------------1-----1--11-------1-----1-------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------11-11111111-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 44 STR:RPRED 21.0 SQ:SECSTR ############################################ccGGGTT#####cGGGGTGGGGccccHHHHHHHHHHHHHHHHHHHHHHc##################################################################################################################### PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccc //