[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81457.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.22.1
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->148 1wwiA PDBj 1e-65 98.6 %
:RPS:SCOP  2->148 1wwiA1  a.22.1.4 * 1e-48 86.4 %
:HMM:SCOP  1->148 1wwiA1 a.22.1.4 * 1.4e-58 57.4 %
:RPS:PFM   8->145 PF09123 * DUF1931 1e-31 57.2 %
:HMM:PFM   8->145 PF09123 * DUF1931 1.5e-58 60.1 138/138  
:BLT:SWISS 1->148 Y1509_METJA 7e-10 23.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81457.1 GT:GENE AAS81457.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1085220..1085666) GB:FROM 1085220 GB:TO 1085666 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81457.1 GB:DB_XREF GI:46197042 LENGTH 148 SQ:AASEQ MLMKVAEFERLFRQAAGLDVDKNDLKRVSDFLRDKLYDLLAVAERNAKYNGRDLIFEPDLPIAKGLQETLQEFRRMDTALELKPVLDALAALPPLDLEVAEDVRNLLPELAGALVVAYARVLKELDPALKNPQTEHHERAERVFNLLL GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 1->148|Y1509_METJA|7e-10|23.6|148/153| SEG 85->101|vldalaalppldlevae| BL:PDB:NREP 1 BL:PDB:REP 3->148|1wwiA|1e-65|98.6|145/145| RP:PFM:NREP 1 RP:PFM:REP 8->145|PF09123|1e-31|57.2|138/138|DUF1931| HM:PFM:NREP 1 HM:PFM:REP 8->145|PF09123|1.5e-58|60.1|138/138|DUF1931| RP:SCP:NREP 1 RP:SCP:REP 2->148|1wwiA1|1e-48|86.4|147/148|a.22.1.4| HM:SCP:REP 1->148|1wwiA1|1.4e-58|57.4|148/0|a.22.1.4|1/1|Histone-fold| OP:NHOMO 18 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------1-11--------- --------------------------------------31-1--------------1----------1--------------1--1---------------------------------------------------------------------------------1-1----------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 98.6 SQ:SECSTR ##ccHHHHHHHHHHHHcccccGGGHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEcGGGccccHHHHHHHHHHHTccccccHHHHHHHHHTccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHcTTcccccHHHHHHHHHHHHHHc DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHc //