[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81458.1
DDBJ      :             small heat shock protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->115 3glaB PDBj 1e-06 29.3 %
:RPS:PDB   34->110 2bolA PDBj 2e-13 15.1 %
:RPS:SCOP  17->115 1gmeA  b.15.1.1 * 1e-12 28.3 %
:HMM:SCOP  24->135 1shsA_ b.15.1.1 * 4.3e-26 34.5 %
:RPS:PFM   37->115 PF00011 * HSP20 4e-07 34.2 %
:HMM:PFM   38->135 PF00011 * HSP20 1.9e-24 29.6 98/102  
:BLT:SWISS 30->115 HSPC4_RICFE 1e-11 31.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81458.1 GT:GENE AAS81458.1 GT:PRODUCT small heat shock protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1085734..1086147) GB:FROM 1085734 GB:TO 1086147 GB:DIRECTION - GB:PRODUCT small heat shock protein GB:PROTEIN_ID AAS81458.1 GB:DB_XREF GI:46197043 LENGTH 137 SQ:AASEQ MLEKLWPFGRSRVRKAVEEALEKAFQDVGEVLEPLSELSEHEDHYLLRVEVPGLGPENLEVRLEGDQLVIEGEKKEEKRAKHLAEIVYGRIYRAYLLPKDAKKEGIEARLAKGVLEVRIPREKRPEEPPVRIPIQES GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 30->115|HSPC4_RICFE|1e-11|31.4|86/163| SEG 116->134|evriprekrpeeppvripi| BL:PDB:NREP 1 BL:PDB:REP 34->115|3glaB|1e-06|29.3|82/99| RP:PDB:NREP 1 RP:PDB:REP 34->110|2bolA|2e-13|15.1|73/301| RP:PFM:NREP 1 RP:PFM:REP 37->115|PF00011|4e-07|34.2|79/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 38->135|PF00011|1.9e-24|29.6|98/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 17->115|1gmeA|1e-12|28.3|99/150|b.15.1.1| HM:SCP:REP 24->135|1shsA_|4.3e-26|34.5|110/115|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 44 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------1---1-------------------------------------1---------------------1--------11---------------------------------------------22-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------11---1------------------------------------------------------------------2-1-------1-----------------------------------------1-----------------1-----------------1--1-1-11----------11-1-11-----1--------------------------------------------------------------11-----------------------------------------------------------------------------------------------------11-1---------------------------2--------------1-------------------------------------1111----------------------------------------------------------- --------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 62.0 SQ:SECSTR ##############################ccccEEEcTTccEEEEEEEEcTTccTTTEEEEEETTEEEEEEcccccTTcTcccccccccEEEEEEccTTccGGGcEEEEETTEE###################### DISOP:02AL 76-81, 123-131, 134-137| PSIPRED cccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEcccEEEEEEEEccccccEEEEEEEccEEEEEEEccccccccEEEEEEEEEEEEEEEccccccccEEEEEEEccEEEEEEEcccccccccEEEEEEEc //