[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81461.1
DDBJ      :             heat-stable protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.159.1
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->228 1uf3A PDBj e-125 100.0 %
:RPS:PDB   29->214 2bq8X PDBj 7e-04 9.1 %
:RPS:SCOP  2->228 1uf3A  d.159.1.6 * 2e-92 97.8 %
:HMM:SCOP  1->228 1uf3A_ d.159.1.6 * 1.8e-51 30.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81461.1 GT:GENE AAS81461.1 GT:PRODUCT heat-stable protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1087156..1087842) GB:FROM 1087156 GB:TO 1087842 GB:DIRECTION - GB:PRODUCT heat-stable protein GB:PROTEIN_ID AAS81461.1 GB:DB_XREF GI:46197046 LENGTH 228 SQ:AASEQ MRRTVRYILATSNPMGDLEALEKFVKLAPDTGADAIALIGNLMPKAAKSRDYAAFFRILSEAHLPTAYVPGPQDAPIWEYLREAANVELVHPEMRNVHETFTFWRGPYLVAGVGGEIADEGEPEEHEALRYPAWVAEYRLKALWELKDYPKIFLFHTMPYHKGLNEQGSHEVAHLIKTHNPLLVLVAGKGQKHEMLGASWVVVPGDLSEGEYSLLDLRARKLETGNVR GT:EXON 1|1-228:0| BL:PDB:NREP 1 BL:PDB:REP 2->228|1uf3A|e-125|100.0|222/222| RP:PDB:NREP 1 RP:PDB:REP 29->214|2bq8X|7e-04|9.1|186/304| RP:SCP:NREP 1 RP:SCP:REP 2->228|1uf3A|2e-92|97.8|227/228|d.159.1.6| HM:SCP:REP 1->228|1uf3A_|1.8e-51|30.3|228/0|d.159.1.6|1/1|Metallo-dependent phosphatases| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 227 STR:RPRED 99.6 SQ:SECSTR #cccccEEEEEEccTTcHHHHHHHHTHHcccTTcTHHHHHTTTTcccHHHHcccEEEcccHHHHTccHHHHHHGGGTcccEEcccccEEEEEEcTTcccEEEEEEccHHHHHccccTTccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHTHHHHHHTTccEEEEcccEEEEEcTTccEEEEEccccccccccEETTTTEEEEEEcc DISOP:02AL 1-3| PSIPRED cccEEEEEEEEEcccccHHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHcccEEEEccEEEEccEEEEccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHccEEEEcccccccccEEEEEEEcEEEEEcccc //