[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81462.1
DDBJ      :             small heat shock protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  105/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->124 2byuA PDBj 9e-06 37.9 %
:RPS:PDB   33->128 2byuA PDBj 1e-11 27.1 %
:RPS:SCOP  1->130 1gmeA  b.15.1.1 * 8e-17 25.4 %
:HMM:SCOP  1->138 1gmeA_ b.15.1.1 * 1.4e-31 34.1 %
:RPS:PFM   67->135 PF00011 * HSP20 5e-09 40.6 %
:HMM:PFM   36->135 PF00011 * HSP20 4.1e-22 30.3 99/102  
:BLT:SWISS 1->134 18K2_MYCAV 2e-10 28.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81462.1 GT:GENE AAS81462.1 GT:PRODUCT small heat shock protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1087855..1088268) GB:FROM 1087855 GB:TO 1088268 GB:DIRECTION - GB:PRODUCT small heat shock protein GB:PROTEIN_ID AAS81462.1 GB:DB_XREF GI:46197047 LENGTH 137 SQ:AASEQ MMRFDPFKELEELQERLVRAFGAPQQGPRVYAPPVDVWEDEEGLHLLVYLPGVEPEKVEVVAEEGVLSVKAERPFERKENAAYHRLEGTYGTFVRSFNVPSTYDLSKVQARFRHGVLHLLVPRAEATKPKKIQVQVE GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 1->134|18K2_MYCAV|2e-10|28.6|126/138| SEG 51->66|pgvepekvevvaeegv| BL:PDB:NREP 1 BL:PDB:REP 67->124|2byuA|9e-06|37.9|58/101| RP:PDB:NREP 1 RP:PDB:REP 33->128|2byuA|1e-11|27.1|96/101| RP:PFM:NREP 1 RP:PFM:REP 67->135|PF00011|5e-09|40.6|69/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 36->135|PF00011|4.1e-22|30.3|99/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 1->130|1gmeA|8e-17|25.4|130/150|b.15.1.1| HM:SCP:REP 1->138|1gmeA_|1.4e-31|34.1|138/0|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 130 OP:NHOMOORG 106 OP:PATTERN -------------------------------------------------------------------- 1-1------------2---------1------1-----32-1-------112111------------2----------------------------------------2----------------1111111111-11111------1-111-11------------212-------------11122-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1-----------2-1--------------------------------------1--------------------------------------------------------1-------------------1----------1--1-----------1---2-----------------1-----------11-----2---11--------11121212212121-12---------------------111-11--1-1----------------------------1111---------------------------------------------------------------------------------------------11111----2-1-------------------------------------------------------1-------------------------111--3-------------------------------------------1--11-----1-- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 83.9 SQ:SECSTR ######################cccccccEEcccEEEEEcccEEEEEEEcTTccGGGEEEEEETTTEEEEEcccccccTTccccccccccccEEEEEEccccccGGGcEEEEETTEEEEEEEccccccccccccccc DISOP:02AL 74-81, 127-132| PSIPRED cccccHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccEEEEEEEEccccHHHEEEEEEccEEEEEEEEccccccccEEEEEEEEccEEEEEEEccccccccEEEEEEEccEEEEEEcccccccccEEEEEEc //