[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81474.1
DDBJ      :             arginase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  206/915 : Eukaryota  171/199 : Viruses  0/175   --->[See Alignment]
c.42.1
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->300 2ef4A PDBj e-132 97.9 %
:RPS:PDB   11->300 2ef4A PDBj 4e-66 87.6 %
:RPS:SCOP  10->299 1cevA  c.42.1.1 * 6e-49 48.4 %
:HMM:SCOP  11->300 1pq3A_ c.42.1.1 * 2.1e-87 49.7 %
:RPS:PFM   13->286 PF00491 * Arginase 2e-41 47.6 %
:HMM:PFM   12->295 PF00491 * Arginase 6.8e-84 50.0 256/274  
:BLT:SWISS 13->299 ARGI_BACSU 1e-69 49.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81474.1 GT:GENE AAS81474.1 GT:PRODUCT arginase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1100717..1101619) GB:FROM 1100717 GB:TO 1101619 GB:DIRECTION - GB:PRODUCT arginase GB:PROTEIN_ID AAS81474.1 GB:DB_XREF GI:46197060 LENGTH 300 SQ:AASEQ MDVSATMPPMERVAVVGVPMDLGANRRGVDMGPSALRYARLLEQLEDLGYTVEDLGDVPVSLARASRRRGRGLAYLEEIRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAARGRRVGVVWVDAHADFNTPETSPSGNVHGMPLAVLSGLGHPRLTEVFRAVDPKDVVLVGVRSLDPGEKRLLKEAGVRVYTMHEVDRLGVARIAEEVLKHLQGLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILAESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRIF GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 13->299|ARGI_BACSU|1e-69|49.5|279/296| SEG 61->74|slarasrrrgrgla| SEG 113->125|vagaargrrvgvv| SEG 233->248|ptlapgvgtpvpgglt| BL:PDB:NREP 1 BL:PDB:REP 11->300|2ef4A|e-132|97.9|282/282| RP:PDB:NREP 1 RP:PDB:REP 11->300|2ef4A|4e-66|87.6|282/282| RP:PFM:NREP 1 RP:PFM:REP 13->286|PF00491|2e-41|47.6|248/266|Arginase| HM:PFM:NREP 1 HM:PFM:REP 12->295|PF00491|6.8e-84|50.0|256/274|Arginase| GO:PFM:NREP 2 GO:PFM GO:0016813|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines"|PF00491|IPR006035| GO:PFM GO:0046872|"GO:metal ion binding"|PF00491|IPR006035| RP:SCP:NREP 1 RP:SCP:REP 10->299|1cevA|6e-49|48.4|287/299|c.42.1.1| HM:SCP:REP 11->300|1pq3A_|2.1e-87|49.7|290/306|c.42.1.1|1/1|Arginase/deacetylase| OP:NHOMO 566 OP:NHOMOORG 381 OP:PATTERN -------------------1----2--1--1------------------------------------- 111------------------------------111-1-----------111-------------1----------------2----------1-------1---21--1--------------------------11122---1--------------------------------------11122---1222222223312323332322122232112-11------11111111111111111----1-----------------------------------------------------------------------111--------------------1---1----11-----1-------1-1-----------1-11111-1111111111111111-3212112114--522323233333--1--1-21111112------------------------------------------------1---1111-------------11----------1-1--11111111212121---1---------------111--1-------1----111-------------------------1-1111111-------------1--------------------------1------------------------------------------------------------------------------------------------------------1------------------------1---1111-1----1------1---------------------111111111111--------------------------------------------------------------- 12----1-31--11111211111111211-1-111-11111111111111122211111111111111-1111211111111111111-11111111111111122-24222422311122123222415G3-5252221312222222222222111222-1221111121121---1C-----1--12--112211- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 291 STR:RPRED 97.0 SQ:SECSTR #########ccEEEEEEEccccccccccGGGHHHHHHHTTHHHHHHHHTcEEEEEEEccccccccTccTTTcccTHHHHHHHHHHHHHHHHTccTTEEEEEEEccGGGHHHHHHHHTTTcccEEEEEccccccccTTTcccccGGGcHHHHHTTcccHHHHHHHccccGGGEEEEEEccccHHHHHHHHHHTcEEEEHHHHHHHcHHHHHHHHHHHTTTccEEEEEEGGGccTTTcccccccccccccHHHHHHHHHHHHHHTcEEEEEEEcccTTTccTTHHHHHHHHHHHHHTTcccc DISOP:02AL 1-7| PSIPRED ccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHcHHHccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcccccEEEEEEEcccccccccccccccHHHHHHHHHHHcccHHHHHHHcccccccEEEEEEccccHHHHHHHHHcccEEEEHHHHHHccHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHcc //