[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81483.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:248 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   81->210 PF01578 * Cytochrom_C_asm 3.5e-14 25.4 130/214  
:BLT:SWISS 118->192 CCSA_THEEB 8e-05 33.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81483.1 GT:GENE AAS81483.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1110337..1111083) GB:FROM 1110337 GB:TO 1111083 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81483.1 GB:DB_XREF GI:46197069 LENGTH 248 SQ:AASEQ MTLALAFLGVVGVAFGVFLPAGLSWGGAFLLLGALFHALAEGPFAGPAQVALVLGGLLALRGKTLWDRPRLRPLGRYLAFLALLLGLFALRSLPHPGGDLPLLLTLFHAGAFLVAYLALSVGVGAGAMCALQDLRLRLAPERAVAAAPLWSLRRLERGYLRVGYVAATLGLASGMAWAFGYFGSPLSPDPKEVSVVLGWLLLTLYFLLDERLRGLLRAGLLLGAYALFLFALLGAPFLGSRHPSGLGF GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 118->192|CCSA_THEEB|8e-05|33.3|72/319| TM:NTM 7 TM:REGION 10->32| TM:REGION 40->61| TM:REGION 72->94| TM:REGION 103->125| TM:REGION 159->181| TM:REGION 190->211| TM:REGION 216->238| SEG 3->42|lalaflgvvgvafgvflpaglswggaflllgalfhalaeg| SEG 50->60|valvlggllal| SEG 74->106|lgrylaflalllglfalrslphpggdlpllltl| SEG 197->239|lgwllltlyfllderlrgllraglllgayalflfallgapflg| HM:PFM:NREP 1 HM:PFM:REP 81->210|PF01578|3.5e-14|25.4|130/214|Cytochrom_C_asm| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 244-248| PSIPRED cHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc //