[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81484.1
DDBJ      :             glutamyl-tRNA reductase
Swiss-Prot:HEM1_THET2   RecName: Full=Glutamyl-tRNA reductase;         Short=GluTR;         EC=1.2.1.70;

Homologs  Archaea  56/68 : Bacteria  606/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
c.124.1c.2.1d.58.39
:390 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->303 1gpjA PDBj 1e-45 37.8 %
:RPS:PDB   50->118 2eggA PDBj 7e-08 21.9 %
:RPS:PDB   174->319 2cy0B PDBj 7e-12 20.1 %
:RPS:SCOP  5->145 1gpjA3  d.58.39.1 * 2e-37 40.6 %
:RPS:SCOP  175->293 1ks2A1  c.124.1.4 * 9e-08 12.8 %
:HMM:SCOP  2->145 1gpjA3 d.58.39.1 * 2.8e-42 53.6 %
:HMM:SCOP  146->298 1gpjA2 c.2.1.7 * 1.6e-37 33.3 %
:RPS:PFM   8->143 PF05201 * GlutR_N 1e-26 47.8 %
:RPS:PFM   165->239 PF01488 * Shikimate_DH 4e-07 46.7 %
:HMM:PFM   8->144 PF05201 * GlutR_N 7.4e-42 49.6 135/152  
:HMM:PFM   159->288 PF01488 * Shikimate_DH 5.3e-36 44.6 130/135  
:HMM:PFM   302->339 PF00745 * GlutR_dimer 2.4e-06 31.6 38/101  
:BLT:SWISS 1->390 HEM1_THET2 0.0 100.0 %
:PROS 86->109|PS00747|GLUTR
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81484.1 GT:GENE AAS81484.1 GT:PRODUCT glutamyl-tRNA reductase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1111080..1112252) GB:FROM 1111080 GB:TO 1112252 GB:DIRECTION - GB:PRODUCT glutamyl-tRNA reductase GB:PROTEIN_ID AAS81484.1 GB:DB_XREF GI:46197070 LENGTH 390 SQ:AASEQ MALPLYLVGLSHKTAPLEVRERAALDPVVALPAALSALGKGVVLSTCNRTELYGVGSPEKARAFLLSRGVVPRHLYVKEGVEALRHLYRVAAGLDSLVVGEAQILGQVREALFLARRQGATESLLEKAFQSAIALGKRARSETGIGMGAVSVAYAALDLALAVYGDLSGLSVAVLGAGEMAELFLTHLKAHGVGRILVVNRTEEKAQALAERFGGEAFGLPALPQVLRQADLVVASAAAPHYLVGPEDLPKRAKPLFLIDIALPRNIDPRVGDLPHAYLYNLDDLKRVVDRNLRARAGEIPKVEALIEKALGDYMEWYAGHRVREAIRALEAWARVQAAKAQPEAGPVELEKAAGRLAHPFILGLKRRALDRVGGPPCPEDCLLYRLSRT GT:EXON 1|1-390:0| SW:ID HEM1_THET2 SW:DE RecName: Full=Glutamyl-tRNA reductase; Short=GluTR; EC=1.2.1.70; SW:GN Name=hemA; OrderedLocusNames=TT_C1142; SW:KW Complete proteome; NADP; Oxidoreductase; Porphyrin biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->390|HEM1_THET2|0.0|100.0|390/390| GO:SWS:NREP 3 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006779|"GO:porphyrin biosynthetic process"|Porphyrin biosynthesis| PROS 86->109|PS00747|GLUTR|PDOC00608| TM:NTM 2 TM:REGION 25->47| TM:REGION 149->171| SEG 23->38|aaldpvvalpaalsal| SEG 149->163|avsvayaaldlalav| BL:PDB:NREP 1 BL:PDB:REP 5->303|1gpjA|1e-45|37.8|296/399| RP:PDB:NREP 2 RP:PDB:REP 50->118|2eggA|7e-08|21.9|64/278| RP:PDB:REP 174->319|2cy0B|7e-12|20.1|139/263| RP:PFM:NREP 2 RP:PFM:REP 8->143|PF05201|1e-26|47.8|136/152|GlutR_N| RP:PFM:REP 165->239|PF01488|4e-07|46.7|75/115|Shikimate_DH| HM:PFM:NREP 3 HM:PFM:REP 8->144|PF05201|7.4e-42|49.6|135/152|GlutR_N| HM:PFM:REP 159->288|PF01488|5.3e-36|44.6|130/135|Shikimate_DH| HM:PFM:REP 302->339|PF00745|2.4e-06|31.6|38/101|GlutR_dimer| GO:PFM:NREP 7 GO:PFM GO:0008883|"GO:glutamyl-tRNA reductase activity"|PF05201|IPR015895| GO:PFM GO:0033014|"GO:tetrapyrrole biosynthetic process"|PF05201|IPR015895| GO:PFM GO:0050661|"GO:NADP or NADPH binding"|PF05201|IPR015895| GO:PFM GO:0055114|"GO:oxidation reduction"|PF05201|IPR015895| GO:PFM GO:0004764|"GO:shikimate 5-dehydrogenase activity"|PF01488|IPR006151| GO:PFM GO:0005737|"GO:cytoplasm"|PF01488|IPR006151| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01488|IPR006151| RP:SCP:NREP 2 RP:SCP:REP 5->145|1gpjA3|2e-37|40.6|138/143|d.58.39.1| RP:SCP:REP 175->293|1ks2A1|9e-08|12.8|109/146|c.124.1.4| HM:SCP:REP 2->145|1gpjA3|2.8e-42|53.6|138/0|d.58.39.1|1/1|Glutamyl tRNA-reductase catalytic, N-terminal domain| HM:SCP:REP 146->298|1gpjA2|1.6e-37|33.3|153/0|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 722 OP:NHOMOORG 682 OP:PATTERN 11-1-11111111111-1122111111111111111111111111111111111-------111--22 1211111111111111111-1111111111111111111111111-1111111111-11111111111111--------111111111-----------112111111111111111111111111111111111111111---11111111111111111111111111111111111111111111---11111111111111111111111111111111111111111111111111111111111111-------------11---------------------------------------------1---------11111-------1-1----1111211---1-2111111--1111--1-11-11--------------------------------------------------------------------------------------1-1-----------------------------------11111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111122221111111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111-111111111111111111111111111---111111111111111111111-----11111111111111111111111111111111111111111111111111111111111111111111111111----------------------------------------------11-----111 ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1111I111113124-3311----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 349 STR:RPRED 89.5 SQ:SECSTR ####EEEEEEETTTccHHHHHHHccccTTHHHHHHHHHTccEEEEETTEcEEEEEEccTTccHHHHHHHTTcTHHHHHTTccEEEEEEEccTTcHHHHHHHHHHHTccEEEEcTTcTTTTGGGcEcHHHHHHTcccEEEEETTEEEEEccHHHHHHHHHHHHTTcccTTTcccEEcccHHHHHHHHHHHHTTcccEEEEcccHHHHHHHHHHTTcEEEcEEccGGGGGGccEEEEcccTTTTccccccGGGcccccEEEEccccccccHHHHHHHHTTcEEEccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHTHHHHHTcHHHHHHHHHccHHHHHcHHHHHHHHHH##################################### DISOP:02AL 291-298, 339-344| PSIPRED ccEEEEEEEEEEEEccHHHHHHcccHHHHHHHHHHHccccEEEEEccccEEEEEEEcHHHHHHHHccHHHccHHHHEEEcHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccEEEEHHHHHHHHccccEEEEEccccccEEcHHHHccccccEEEEEccccccccHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccc //