[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81488.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.61.6
:187 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->145 1y0gA PDBj 7e-06 36.6 %
:RPS:SCOP  39->144 1wubA  b.61.6.1 * 6e-14 26.3 %
:HMM:SCOP  18->187 1wubA_ b.61.6.1 * 3e-20 25.5 %
:RPS:PFM   62->145 PF04264 * YceI 1e-05 34.6 %
:HMM:PFM   23->184 PF04264 * YceI 5.1e-23 24.2 149/159  
:BLT:SWISS 53->143 Y4850_VIBPA 1e-05 38.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81488.1 GT:GENE AAS81488.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1114040..1114603 GB:FROM 1114040 GB:TO 1114603 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81488.1 GB:DB_XREF GI:46197074 LENGTH 187 SQ:AASEQ MKGWLFAAALFALTALAQTFQVASGEARYRVREELLRVGLTDAVGTTKAVRGEVRLQDGRVSGEFVVDLRELKSDQARRDNYLRQRTLETDRYPFATFRPKEVRGLPNPLPRQGKVPIQVVGDLTIKGVTAEVVWEGEAEFQGDEVRVFLRTEFPFEKFRLAQPRVSVVLSLENRIRLEVELVLRRQ GT:EXON 1|1-187:0| BL:SWS:NREP 1 BL:SWS:REP 53->143|Y4850_VIBPA|1e-05|38.8|80/189| TM:NTM 1 TM:REGION 2->24| SEG 5->21|lfaaalfaltalaqtfq| SEG 172->186|lenrirlevelvlrr| BL:PDB:NREP 1 BL:PDB:REP 67->145|1y0gA|7e-06|36.6|71/169| RP:PFM:NREP 1 RP:PFM:REP 62->145|PF04264|1e-05|34.6|78/161|YceI| HM:PFM:NREP 1 HM:PFM:REP 23->184|PF04264|5.1e-23|24.2|149/159|YceI| RP:SCP:NREP 1 RP:SCP:REP 39->144|1wubA|6e-14|26.3|99/176|b.61.6.1| HM:SCP:REP 18->187|1wubA_|3e-20|25.5|161/0|b.61.6.1|1/1|YceI-like| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------1-1-----22----------------------------------------------------------------------------------------11---11--------------------1-------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 57.8 SQ:SECSTR #####################################TTTEEEEEEEEEEEEEEEEcTccEEEEEEEEGGGEEcccHHHHHHHHcTTTcTTTccEEEEEEEEEEEEEEEEEEETTTEEEEEEEEEETTEEEEEEEEEEEEEEEEc########################################## DISOP:02AL 187-188| PSIPRED cHHHHHHHHHHHHHHccEEEEEcccccEEEEEEEEEEccEEEEEEEEccEEEEEEEEccccEEEEEEEcccEEccHHHHHHHHccccccHHcccEEEEEEEEEEEccccccccccEEEEEEEEEEEccEEEEEEEEEEEEEEccEEEEEEEEEEEEHHccccccccccccEEcEEEEEEEEEEEEEc //