[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81506.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.319.1
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->127 1wn9A PDBj 5e-52 100.0 %
:RPS:SCOP  2->127 1wn9A1  d.319.1.1 * 1e-50 84.1 %
:HMM:SCOP  1->127 1wnaA1 d.319.1.1 * 9.1e-60 59.1 %
:RPS:PFM   30->126 PF11432 * DUF3197 5e-27 71.1 %
:HMM:PFM   14->126 PF11432 * DUF3197 1.6e-56 58.0 112/113  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81506.1 GT:GENE AAS81506.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1131069..1131464) GB:FROM 1131069 GB:TO 1131464 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81506.1 GB:DB_XREF GI:46197092 LENGTH 131 SQ:AASEQ MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGLLLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA GT:EXON 1|1-131:0| SEG 13->29|slealkaalgglklsea| BL:PDB:NREP 1 BL:PDB:REP 2->127|1wn9A|5e-52|100.0|123/123| RP:PFM:NREP 1 RP:PFM:REP 30->126|PF11432|5e-27|71.1|97/114|DUF3197| HM:PFM:NREP 1 HM:PFM:REP 14->126|PF11432|1.6e-56|58.0|112/113|DUF3197| RP:SCP:NREP 1 RP:SCP:REP 2->127|1wn9A1|1e-50|84.1|126/127|d.319.1.1| HM:SCP:REP 1->127|1wnaA1|9.1e-60|59.1|127/0|d.319.1.1|1/1|TTHA1528-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 93.9 SQ:SECSTR #EEcc#TTcHHHHHHHHHHHHTTcccTTcEEEEEEEccccGGGccEEEEEEccccEEEEEEEEcTTcTTHHHHHHHHHHHHHHTTccEEEEEEEcGGG#HHHHTccHHHHHHHH#HHcEEccGGGGc#### DISOP:02AL 1-7| PSIPRED ccccccccccHHHHHHHHHHHccccccccEEEEEEcccccccHHHHHHHHHHcHHHHccccccccccccHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHcccHHHHHHHHHHccccccccEEEccc //